VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen

Images

 
There are currently no images for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen (NBP3-21352PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VDR/NR1I1/Vitamin D Receptor

Source: E.coli

Amino Acid Sequence: PGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VDR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21352. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen

  • NR1I1
  • NR1I1Nuclear receptor subfamily 1 group I member 11,25-dihydroxyvitamin D3 receptor
  • VDR
  • vitamin D1,25- dihydroxyvitamin D3 receptor
  • vitamin D3 receptor

Background

Vitamin D Receptor encodes the nuclear hormone receptor for vitamin D3. This receptor also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarity to the steroid and thyroid hormone receptors. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Mutations in this gene are associated with type II vitamin D-resistant rickets. A single nucleotide polymorphism in the initiation codon results in an alternate translation start site three codons downstream. Alternative splicing results in multiple transcript variants encoding the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7665
Species: Hu
Applications: IHC, WB
NBP1-85495
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-89953
Species: Hu
Applications: IHC,  IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
NBP1-86713
Species: Hu
Applications: IHC,  IHC-P
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00001594-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NB120-19347
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-45516
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
NB100-2574
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NBP2-50028
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
NBP3-21352PEP
Species: Hu
Applications: AC

Publications for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen (NBP3-21352PEP) (0)

There are no publications for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen (NBP3-21352PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen (NBP3-21352PEP) (0)

There are no reviews for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen (NBP3-21352PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen (NBP3-21352PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VDR/NR1I1/Vitamin D Receptor Products

Research Areas for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen (NBP3-21352PEP)

Find related products by research area.

Blogs on VDR/NR1I1/Vitamin D Receptor

There are no specific blogs for VDR/NR1I1/Vitamin D Receptor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol VDR