CYP24A1 Antibody

Images

 
Western Blot: CYP24A1 Antibody [NBP1-85495] - Lane 1: Marker [kDa] 250,130,100,70,55,35,25,15,10. Lane 2: Human cell line A-549
Immunocytochemistry/ Immunofluorescence: CYP24A1 Antibody [NBP1-85495] - Immunofluorescent staining of human cell line A549 shows localization to mitochondria.
Immunohistochemistry-Paraffin: CYP24A1 Antibody [NBP1-85495] - Staining of human urinary bladder shows cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP24A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP24A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CYP24A1 Protein (NBP1-85495PEP)
Publications
Read Publication using NBP1-85495.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23334593)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CYP24A1 Antibody

  • 25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
  • CP241
  • CYP241,25-alphadihydroxyvitamin D3 24-hydroxylase
  • Cytochrome P450 24A1
  • cytochrome P450, family 24, subfamily A, polypeptide 1,24-OHase
  • cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase)
  • Cytochrome P450-CC24
  • EC 1.14.13.n4
  • exo-mitochondrial protein
  • MGC126273
  • MGC126274
  • P450-CC24
  • vitamin D 24-hydroxylase
  • Vitamin D(3) 24-hydroxylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP2-32433
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-35213
Species: Hu
NBP2-50204
Species: Hu, Mu
Applications: WB, ELISA, IHC
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
2629-FG/CF
Species: Mu
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-46005
Species: Hu
Applications: WB, IHC, IF

Publications for CYP24A1 Antibody (NBP1-85495)(1)

Reviews for CYP24A1 Antibody (NBP1-85495) (0)

There are no reviews for CYP24A1 Antibody (NBP1-85495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CYP24A1 Antibody (NBP1-85495) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP24A1 Products

Bioinformatics Tool for CYP24A1 Antibody (NBP1-85495)

Discover related pathways, diseases and genes to CYP24A1 Antibody (NBP1-85495). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP24A1 Antibody (NBP1-85495)

Discover more about diseases related to CYP24A1 Antibody (NBP1-85495).
 

Pathways for CYP24A1 Antibody (NBP1-85495)

View related products by pathway.

PTMs for CYP24A1 Antibody (NBP1-85495)

Learn more about PTMs related to CYP24A1 Antibody (NBP1-85495).

Blogs on CYP24A1

There are no specific blogs for CYP24A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP24A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP24A1