Recombinant Human CYP27B1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CYP27B1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 409-508 of Human CYP27B1

Source: Wheat Germ

Amino Acid Sequence: TLCHYATSRDPAQFPEPNSFRPARWLGEGPTPHPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CYP27B1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CYP27B1 Protein

  • 1alpha(OH)ase
  • 25 hydroxyvitamin D3-1-alpha hydroxylase
  • 25-hydroxyvitamin D(3) 1-alpha-hydroxylase
  • 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
  • 25-OHD-1 alpha-hydroxylase
  • Calcidiol 1-monooxygenase
  • CP2B
  • CYP1
  • CYP1alpha
  • CYP27B
  • Cytochrome p450 27B1
  • Cytochrome P450 subfamily XXVIIB polypeptide 1
  • cytochrome P450, family 27, subfamily B, polypeptide 1
  • cytochrome P450, subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase)
  • Cytochrome P450C1 alpha
  • Cytochrome P450VD1-alpha
  • EC 1.14.13.13
  • P450c1
  • PDDR
  • polypeptide 1
  • VD3 1A hydroxylase
  • VDD1
  • VDDR
  • VDDRI
  • VDR

Background

CYP27B1 - cytochrome P450, family 27, subfamily B, polypeptide 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65676
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-76827
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24722
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
7270-IL/CF
Species: Hu
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
H00001594-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CYP27B1 Partial Recombinant Protein (H00001594-Q01) (0)

There are no publications for CYP27B1 Partial Recombinant Protein (H00001594-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP27B1 Partial Recombinant Protein (H00001594-Q01) (0)

There are no reviews for CYP27B1 Partial Recombinant Protein (H00001594-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP27B1 Partial Recombinant Protein (H00001594-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional CYP27B1 Products

Array H00001594-Q01

Bioinformatics Tool for CYP27B1 Partial Recombinant Protein (H00001594-Q01)

Discover related pathways, diseases and genes to CYP27B1 Partial Recombinant Protein (H00001594-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP27B1 Partial Recombinant Protein (H00001594-Q01)

Discover more about diseases related to CYP27B1 Partial Recombinant Protein (H00001594-Q01).
 

Pathways for CYP27B1 Partial Recombinant Protein (H00001594-Q01)

View related products by pathway.

PTMs for CYP27B1 Partial Recombinant Protein (H00001594-Q01)

Learn more about PTMs related to CYP27B1 Partial Recombinant Protein (H00001594-Q01).

Blogs on CYP27B1

There are no specific blogs for CYP27B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CYP27B1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP27B1