VASA Antibody


Western Blot: VASA Antibody [NBP2-13908] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane more
Immunohistochemistry-Paraffin: VASA Antibody [NBP2-13908] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

VASA Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GGESSDTQGPKVTYIPPPPPEDEDSIFAHYQTGINFDKYDTILVEVSGHD APPAILTFEEANLCQTLNNNIAKAGYTK
Primordial Germ Cell Marker
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VASA Protein (NBP2-13908PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for VASA Antibody

  • DDX4
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 4
  • DEAD box protein 4
  • EC 3.6.1
  • EC
  • MGC111074
  • probable ATP-dependent RNA helicase DDX4
  • Vasa homolog
  • VASA
  • VASADEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Rb, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ChIP, ICC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for VASA Antibody (NBP2-13908) (0)

There are no publications for VASA Antibody (NBP2-13908).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VASA Antibody (NBP2-13908) (0)

There are no reviews for VASA Antibody (NBP2-13908). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VASA Antibody (NBP2-13908) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional VASA Products

Bioinformatics Tool for VASA Antibody (NBP2-13908)

Discover related pathways, diseases and genes to VASA Antibody (NBP2-13908). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VASA Antibody (NBP2-13908)

Discover more about diseases related to VASA Antibody (NBP2-13908).

Pathways for VASA Antibody (NBP2-13908)

View related products by pathway.

PTMs for VASA Antibody (NBP2-13908)

Learn more about PTMs related to VASA Antibody (NBP2-13908).

Blogs on VASA

There are no specific blogs for VASA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our VASA Antibody and receive a gift card or discount.


Gene Symbol DDX4