![Immunocytochemistry/Immunofluorescence: USP45 Antibody [NBP1-81200] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize/USP45-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81200-img0007.jpg "Immunocytochemistry/Immunofluorescence: USP45 Antibody [NBP1-81200] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EKAKRSKRPTVPHDEDSSDDIAVGLTCQHVSHAISVNHVKRAIAENLWSVCSECLEERRFYDGQLVLTSDIWLCLKCGFQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | USP45 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: USP45 Antibody [NBP1-81200] - Staining of human small intestine shows nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/USP45-Antibody-Immunohistochemistry-Paraffin-NBP1-81200-img0008.jpg "Immunohistochemistry-Paraffin: USP45 Antibody [NBP1-81200] - Staining of human small intestine shows nuclear positivity in glandular cells.")
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![Western Blot EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Western_Blot_16707.jpg)
![Immunohistochemistry EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Immunohistochemistry_17212.jpg)
![Knockout Validated EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Knockout_Validated_22526.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Ubiquitin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Ubiquitin [Unconjugated]")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Western_Blot_5399.jpg)
![Simple Western FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Simple_Western_16755.jpg)
![Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Immunohistochemistry_6823.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")