Splicing factor, arginine/serine-rich 11 Antibody

Images

 
Western Blot: Splicing factor, arginine/serine-rich 11 Antibody [NBP1-87381] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: ...read more
Immunocytochemistry/ Immunofluorescence: Splicing factor, arginine/serine-rich 11 Antibody [NBP1-87381] - Staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: Splicing factor, arginine/serine-rich 11 Antibody [NBP1-87381] - Staining of human colon shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Splicing factor, arginine/serine-rich 11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLPTPNPLTQIGAVPLAALGAPTLDPALAALGLPGANLNSQSLAADQLLKLMSTVDPKLNHVAAGLVSPSLKSDTSSKEIEEAMKRVREAQSLISAAIEPDKKEEKRRHSRSRSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRSF11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Splicing factor, arginine/serine-rich 11 Protein (NBP1-87381PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Splicing factor, arginine/serine-rich 11 Antibody

  • Arginine-rich 54 kDa nuclear protein
  • dJ677H15.2
  • DKFZp686M13204
  • p54NET2
  • serine/arginine-rich splicing factor 11
  • SFRS11
  • splicing factor p54
  • Splicing factor, arginine/serine-rich 11FLJ18226
  • SR splicing factor 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02060
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-92392
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-61045
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1334
Species: Hu
Applications: WB, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Splicing factor, arginine/serine-rich 11 Antibody (NBP1-87381) (0)

There are no publications for Splicing factor, arginine/serine-rich 11 Antibody (NBP1-87381).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Splicing factor, arginine/serine-rich 11 Antibody (NBP1-87381) (0)

There are no reviews for Splicing factor, arginine/serine-rich 11 Antibody (NBP1-87381). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Splicing factor, arginine/serine-rich 11 Antibody (NBP1-87381) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Splicing factor, arginine/serine-rich 11 Products

Bioinformatics Tool for Splicing factor, arginine/serine-rich 11 Antibody (NBP1-87381)

Discover related pathways, diseases and genes to Splicing factor, arginine/serine-rich 11 Antibody (NBP1-87381). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Splicing factor, arginine/serine-rich 11

There are no specific blogs for Splicing factor, arginine/serine-rich 11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Splicing factor, arginine/serine-rich 11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRSF11