LDHD Antibody

Images

 
Western Blot: LDHD Antibody [NBP2-48748] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more
Immunohistochemistry-Paraffin: LDHD Antibody [NBP2-48748] - Staining of human testis shows low expression as expected.
Immunohistochemistry: LDHD Antibody [NBP2-48748] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LDHD Antibody [NBP2-48748] - Staining in human kidney and testis tissues using anti-LDHD antibody. Corresponding LDHD RNA-seq data are presented for the same ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

LDHD Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PWRGYCSQKAKGELCRDFVEALKAVVGGSHVSTAAVVREQHGRDESVHRCEPPDAVVWPQNVEQVSRLAALCYRQGVPIIPFGTGTGLEGGVCAVQG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LDHD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LDHD Recombinant Protein Antigen (NBP2-48748PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LDHD Antibody

  • D-lactate dehydrogenase
  • EC 1.1.2.4
  • lactate dehydrogenase DDLD
  • MGC57726
  • probable D-lactate dehydrogenase, mitochondrial

Background

LDHD is encoded by this gene belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The similar protein in yeast has both D-lactate and D-glycerate dehydrogenase activities. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LDHD Antibody (NBP2-48748) (0)

There are no publications for LDHD Antibody (NBP2-48748).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LDHD Antibody (NBP2-48748) (0)

There are no reviews for LDHD Antibody (NBP2-48748). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LDHD Antibody (NBP2-48748) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LDHD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LDHD