GRASP55 Antibody

Western Blot: GRASP55 Antibody [NBP1-89747] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GORASP2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: GRASP55 Antibody [NBP1-89747] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GRASP55 Antibody [NBP1-89747] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Western Blot: GRASP55 Antibody [NBP1-89747] - Analysis in human cell line HepG2.

Western Blot: GRASP55 Antibody [NBP1-89747] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: GRASP55 Antibody [NBP1-89747] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: GRASP55 Antibody [NBP1-89747] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: GRASP55 Antibody [NBP1-89747] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC, IHC-P, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GRASP55 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GORASP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GRASP55 Protein (NBP1-89747PEP)

Reactivity Notes

Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GRASP55 Antibody

• Golgi phosphoprotein 6
• golgi reassembly stacking protein 2, 55 kDa
• golgi reassembly stacking protein 2, 55kDa
• Golgi reassembly-stacking protein of 55 kDa
• GOLPH6DKFZp434D156
• GRASP55FLJ13139
• GRS2Golgi reassembly-stacking protein 2
• p59

Background

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in establishing the stacked structure of the Golgi apparatus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRASP55 Antibody (NBP1-89747)(1)

Publication using NBP1-89747

• Subramanian A, Capalbo A, Iyengar NR et al. Auto-regulation of Secretory Flux by Sensing and Responding to the Folded Cargo Protein Load in the Endoplasmic Reticulum Cell 2019-03-07 [PMID: 30849374] (ICC/IF, Mouse)

Reviews for GRASP55 Antibody (NBP1-89747) (2)

Average Rating: 4

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Human.

reviewed by: Verified Customer WB Human 04/21/2017

Summary

• Application: Western Blot
• Sample Tested: Cell lysate from HeLa cells
• Species: Human
• Lot: A103873

reviewed by: Ramanath Narayana Hegde WB Human 07/14/2016

Summary

• Application: Western Blot
• Sample Tested: Hela Cell Lysate
• Species: Human
• Lot: A103873

Bioinformatics

• Gene Symbol: GORASP2
• Entrez:
  • 26003(Human)
• Uniprot:
  • Q9H8Y8(Human)