GRASP55 Antibody

Images

 
Genetic Strategies: Western Blot: GRASP55 Antibody [NBP1-89747] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GORASP2 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: GRASP55 Antibody [NBP1-89747] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GRASP55 Antibody [NBP1-89747] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
Western Blot: GRASP55 Antibody [NBP1-89747] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: GRASP55 Antibody [NBP1-89747] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GRASP55 Antibody [NBP1-89747] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: GRASP55 Antibody [NBP1-89747] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

GRASP55 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GORASP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRASP55 Protein (NBP1-89747PEP)
Reviewed Applications
Read 2 Reviews rated 4
using
NBP1-89747 in the following applications:

Publications
Read Publication using
NBP1-89747 in the following applications:

Reactivity Notes

Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRASP55 Antibody

  • Golgi phosphoprotein 6
  • golgi reassembly stacking protein 2, 55 kDa
  • golgi reassembly stacking protein 2, 55kDa
  • Golgi reassembly-stacking protein of 55 kDa
  • GOLPH6DKFZp434D156
  • GRASP55FLJ13139
  • GRS2Golgi reassembly-stacking protein 2
  • p59

Background

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in establishing the stacked structure of the Golgi apparatus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRASP55 Antibody (NBP1-89747)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for GRASP55 Antibody (NBP1-89747) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using NBP1-89747:
Filter by Applications
WB
(2)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot GRASP55 NBP1-89747
Enlarge
4
reviewed by:
Prathyush Pothukuchi
WB Human 04/21/2017
View

Summary

ApplicationWestern Blot
Sample TestedCell lysate from HeLa cells
SpeciesHuman
LotA103873
Western Blot GRASP55 NBP1-89747
Enlarge
4
reviewed by:
Verified Customer
WB Human 07/14/2016
View

Summary

ApplicationWestern Blot
Sample TestedHela Cell Lysate
SpeciesHuman
LotA103873

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GRASP55 Antibody (NBP1-89747) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRASP55 Products

Research Areas for GRASP55 Antibody (NBP1-89747)

Find related products by research area.

Blogs on GRASP55

There are no specific blogs for GRASP55, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
2
3
0
2
0
1
0

Prathyush Pothukuchi
04/21/2017
Application: WB
Species: Human

Verified Customer
07/14/2016
Application: WB
Species: Human

Bioinformatics

Gene Symbol GORASP2
Entrez
Uniprot