GRASP55 Antibody

Images

 
Western Blot: GRASP55 Antibody [NBP1-89747] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: GRASP55 Antibody [NBP1-89747] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GRASP55 Antibody [NBP1-89747] - Staining of human duodenum shows membranous positivity in glandular cells.
Western Blot: GRASP55 Antibody [NBP1-89747] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: GRASP55 Antibody [NBP1-89747] - Staining of human rectum shows strong cytoplasmic positivity in granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRASP55 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GORASP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRASP55 Protein (NBP1-89747PEP)
Reviewed Applications
Read 2 Reviews rated 4
using
NBP1-89747 in the following applications:

Reactivity Notes

Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRASP55 Antibody

  • Golgi phosphoprotein 6
  • golgi reassembly stacking protein 2, 55 kDa
  • golgi reassembly stacking protein 2, 55kDa
  • Golgi reassembly-stacking protein of 55 kDa
  • GOLPH6DKFZp434D156
  • GRASP55FLJ13139
  • GRS2Golgi reassembly-stacking protein 2
  • p59

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46218
Species: Hu
Applications: WB, IHC
NBP1-84084
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02340
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7500
Species: Hu
Applications: WB, ICC
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB3915
Species: Hu, Mu
Applications: WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89747
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GRASP55 Antibody (NBP1-89747) (0)

There are no publications for GRASP55 Antibody (NBP1-89747).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRASP55 Antibody (NBP1-89747) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.
We have 2 reviews tested in 1 application: WB.

Reviews using NBP1-89747:
Filter by Applications
WB
(2)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot GRASP55 NBP1-89747
Enlarge
reviewed by:
Prathyush Pothukuchi
WB Human 04/21/2017
View

Summary

ApplicationWestern Blot
Sample TestedCell lysate from HeLa cells
SpeciesHuman
LotA103873
Western Blot GRASP55 NBP1-89747
Enlarge
reviewed by:
Anonymous
WB Human 07/14/2016
View

Summary

ApplicationWestern Blot
Sample TestedHela Cell Lysate
SpeciesHuman
LotA103873

Blocking

Blocking DetailsTBST with 5% w/v nonfat dry milk for 1 hr at room temperature.

Primary Anitbody

Dilution RatioNBP1-89747 antibody (1:2000 dilution) in TBST with 5% BSA incubated with gentle agitation overnight at 4°C

Secondary Antibody

Secondary DescriptionGoat Anti-Rabbit IgG, H & L Chain Specific Peroxidase Conjugate 1:10000 diluted in 10 ml TBST with 5% w/v nonfat dry milk
Secondary Manufacturer Cat#Cat No: 401315 Merckmillipore
Secondary Concentration1:10000

Details

Detection NotesLuminata Crescendo Western HRP substrate (WBLUR0100 Merckmillipore) for 5 min at RT,exposed the x-ray film for 30 sec.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GRASP55 Antibody (NBP1-89747) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRASP55 Products

Bioinformatics Tool for GRASP55 Antibody (NBP1-89747)

Discover related pathways, diseases and genes to GRASP55 Antibody (NBP1-89747). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRASP55 Antibody (NBP1-89747)

Discover more about diseases related to GRASP55 Antibody (NBP1-89747).
 

Pathways for GRASP55 Antibody (NBP1-89747)

View related products by pathway.

PTMs for GRASP55 Antibody (NBP1-89747)

Learn more about PTMs related to GRASP55 Antibody (NBP1-89747).
 

Research Areas for GRASP55 Antibody (NBP1-89747)

Find related products by research area.

Blogs on GRASP55

There are no specific blogs for GRASP55, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
2
3
0
2
0
1
0

Prathyush Pothukuchi
04/21/2017
Application: WB
Species: Human

Anonymous
07/14/2016
Application: WB
Species: Human

Bioinformatics

Gene Symbol GORASP2
Entrez
Uniprot