USP33 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: USP33 Antibody [NBP3-35652] - Immunofluorescence analysis of NIH-3T3 cells using USP33 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: USP33 Antibody [NBP3-35652] - Immunohistochemistry analysis of paraffin-embedded Rat ovary using USP33 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: USP33 Antibody [NBP3-35652] - Western blot analysis of lysates from HeLa cells, using USP33 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1min.

Immunohistochemistry: USP33 Antibody [NBP3-35652] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using USP33 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: USP33 Antibody [NBP3-35652] - Western blot analysis of lysates from HepG2 cells, using USP33 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3min.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

USP33 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 290-400 of human USP33 (NP_963920.1).
  
  Sequence:
  QVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USP33
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 107 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for USP33 Antibody - BSA Free

• Deubiquitinating enzyme 33
• EC 3.1.2.15
• EC 3.4.19.12
• hVDU1
• KIAA1097
• KIAA1097MGC16868
• pVHL-interacting deubiquitinating enzyme 1
• ubiquitin carboxyl-terminal hydrolase 33
• ubiquitin specific peptidase 33
• ubiquitin thioesterase 33
• Ubiquitin thiolesterase 33
• Ubiquitin-specific-processing protease 33
• USP33
• VDU1
• VDU1ubiquitin specific protease 33
• VHL-interacting deubiquitinating enzyme 1

Background

The ubiquitin dependent protein degradation pathway is essential for the proteolysis of intracellular proteins and peptides. Deubiquitination, is catalyzed by proteases called deubiquitinating enzymes. USP33 is a deubiquitinating enzyme that binds to the von Hippel-Lindau tumor suppressor protein. It also regulates thyroid hormone activation by deubiquitinating type 2 iodothyronine deiodinase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: USP33