UCH-L1/PGP9.5 Antibody

Images

 
Western Blot: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Western Blot: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Analysis in human cerebral cortex tissue.
Western Blot: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Analysis in mouse cerebral cortex tissue.
Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human pancreas shows strong cytoplasmic and nuclear positivity in islet cells.
Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons and in neuropil.
Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Immunohistochemical staining of human liver shows no positivity in hepatocytes, as expected.
Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in peripheral ganglion and peripheral nerves.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UCH-L1/PGP9.5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL
Marker
pan-Neuronal Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UCHL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UCH-L1/PGP9.5 Recombinant Protein Antigen (NBP1-87334PEP)
Publications
Read Publications using
NBP1-87334 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 20587347)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UCH-L1/PGP9.5 Antibody

  • EC 3.4.19.12
  • EC 6.-
  • Neuron cytoplasmic protein 9.5
  • PARK5
  • PGP 9.5
  • PGP9.5
  • PGP9.5Uch-L1
  • PGP95
  • ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
  • ubiquitin carboxyl-terminal hydrolase isozyme L1
  • ubiquitin C-terminal hydrolase
  • Ubiquitin thioesterase L1
  • UCHL1
  • UCH-L1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6008
Species: Hu, Mu, Rt
Applications: WB
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
NBP1-87334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UCH-L1/PGP9.5 Antibody (NBP1-87334)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for UCH-L1/PGP9.5 Antibody (NBP1-87334) (0)

There are no reviews for UCH-L1/PGP9.5 Antibody (NBP1-87334). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UCH-L1/PGP9.5 Antibody (NBP1-87334) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UCH-L1/PGP9.5 Products

Bioinformatics Tool for UCH-L1/PGP9.5 Antibody (NBP1-87334)

Discover related pathways, diseases and genes to UCH-L1/PGP9.5 Antibody (NBP1-87334). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCH-L1/PGP9.5 Antibody (NBP1-87334)

Discover more about diseases related to UCH-L1/PGP9.5 Antibody (NBP1-87334).
 

Pathways for UCH-L1/PGP9.5 Antibody (NBP1-87334)

View related products by pathway.

PTMs for UCH-L1/PGP9.5 Antibody (NBP1-87334)

Learn more about PTMs related to UCH-L1/PGP9.5 Antibody (NBP1-87334).
 

Research Areas for UCH-L1/PGP9.5 Antibody (NBP1-87334)

Find related products by research area.

Blogs on UCH-L1/PGP9.5

There are no specific blogs for UCH-L1/PGP9.5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UCH-L1/PGP9.5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UCHL1
Entrez