Ubiquitin C Antibody - BSA Free

Immunohistochemistry-Paraffin: Ubiquitin C Antibody [NBP2-54692] - Staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ubiquitin C Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ubiquitin C Antibody - BSA Free (NBP2-54692) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQ
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBC
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Ubiquitin C Recombinant Protein Antigen (NBP2-54692PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Ubiquitin C Antibody - BSA Free

• HMG20
• PolyUbiquitin
• polyubiquitin-B
• Polyubiquitin-C
• UBC
• Ubiquitin-40S ribosomal protein S27a
• ubiquitin-60S ribosomal protein L40

Background

Ubiquitin is a small protein that is composed of 76 amino acids and its sequence is highly conserved throughout evolution from invertebrates to mammals. In the cytoplasm, ubiquitin is involved in ATP-dependent nonlysomal proteolysis of various proteins. In the nucleus, ubiquitin is conjugated to histone2A and may play a role in regulation of chromatin structure and/or regulation of transcriptional activity.Ubiquitin(76amino acid) was overexpressed in E.coli and purified by using conventional chromatography techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBC