HMBS Antibody

Images

 
Western Blot: HMBS Antibody [NBP1-87329] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: HMBS Antibody [NBP1-87329] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Western Blot: HMBS Antibody [NBP1-87329] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HMBS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HMBS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HMBS Protein (NBP1-87329PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HMBS Antibody

  • hydroxymethylbilane synthasePre-uroporphyrinogen synthase
  • PBGDPBG-D
  • PORC
  • porphobilinogen deaminase
  • porphyria, acute; Chester type
  • UPSEC 2.5.1.61
  • uroporphyrinogen I synthase
  • uroporphyrinogen I synthetase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P
NB100-127
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-90202
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005498-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
MAB17791
Species: Hu, Mu
Applications: WB
NBP1-92565
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-87329
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for HMBS Antibody (NBP1-87329) (0)

There are no publications for HMBS Antibody (NBP1-87329).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HMBS Antibody (NBP1-87329) (0)

There are no reviews for HMBS Antibody (NBP1-87329). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HMBS Antibody (NBP1-87329) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HMBS Products

Bioinformatics Tool for HMBS Antibody (NBP1-87329)

Discover related pathways, diseases and genes to HMBS Antibody (NBP1-87329). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMBS Antibody (NBP1-87329)

Discover more about diseases related to HMBS Antibody (NBP1-87329).
 

Pathways for HMBS Antibody (NBP1-87329)

View related products by pathway.

PTMs for HMBS Antibody (NBP1-87329)

Learn more about PTMs related to HMBS Antibody (NBP1-87329).
 

Research Areas for HMBS Antibody (NBP1-87329)

Find related products by research area.

Blogs on HMBS

There are no specific blogs for HMBS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HMBS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HMBS