UBASH3B/STS1/Tula-2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: UBASH3B/STS1/Tula-2 Antibody [NBP2-34053] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.

Immunohistochemistry-Paraffin: UBASH3B/STS1/Tula-2 Antibody [NBP2-34053] - Staining of human lymph node shows strong cytoplasmic positivity in germinal and non germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UBASH3B/STS1/Tula-2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKEDSAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASH
• Predicted Species: Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBASH3B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  UBASH3B/STS1/Tula-2 Protein (NBP2-34053PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UBASH3B/STS1/Tula-2 Antibody - BSA Free

• Cbl-interacting Protein p70
• Cbl-interacting protein Sts-1
• KIAA1959SH3 domain-containing 70 kDa protein, suppressor of T-cell receptor signaling1, nm23-phosphorylated unknown substrate
• MGC15437
• nm23-phosphorylated unknown substrate
• p70
• STS1
• STS1EC 3.1.3.48
• STS-1ubiquitin-associated and SH3 domain-containing protein B
• Suppressor of T-cell receptor signaling 1
• T-cell ubiquitin ligand 2
• TULA-2
• Tyrosine-protein phosphatase STS1/TULA2
• UBASH3B
• ubiquitin associated and SH3 domain containing B

Background

Sts-1 is a protein that inhibits endocytosis of epidermal growth factor receptor (EGFR) and platelet-derived growth factor receptor. Sts-1 and Sts-2 (formerly p70 and Clip4, respectively) have been found to interact with Cbl, an ubiquitin ligase that plays a critical role in attenuation of receptor tyrosine kinase signaling by inducing ubiquitination and promoting their sorting for endosomal degradation. Sts-1 and Sts-2 contain SH3 domains that interact with Cbl, Ub-associated domains, which bind directly to mono-Ub or to the EGFR/Ub chimera, as well as phosphoglycerate mutase domains that mediate oligomerization of Sts-1/2. Sts-1 and Sts-2 also have been found to negatively regulate signaling pathways that control T cell receptors, which in turn affect the extent and duration of the T cell response to foreign pathogens.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBASH3B
• Uniprot:
  • Q8TF42(Human)