UBAP1 Antibody - BSA Free

Western Blot: UBAP1 Antibody [NBP1-80651] - Analysis of UBAP1 in Panc-1 and AsPC-1 whole cell lysates using anti-UBAP1 antibody. Image submitted by a verified customer review.

Immunocytochemistry/Immunofluorescence: UBAP1 Antibody [NBP1-80651] - Staining of human cell line A-431 shows localization to plasma membrane, cytosol & the Golgi apparatus.

Immunohistochemistry-Paraffin: UBAP1 Antibody [NBP1-80651] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UBAP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UBAP1 Antibody - BSA Free (NBP1-80651) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-UBAP1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FHGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDFSLEKKTIEWAEEIKKIEEAEREAECKIAEAEAKVNSKSGPEGDSKMSFSKTHS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBAP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Western Blot Validated from a verified customer review.
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, PFA/Triton X-100.
• Control Peptide:

  UBAP1 Protein (NBP1-80651PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UBAP1 Antibody - BSA Free

• MGC119669
• MGC8710
• NAG20
• Nasopharyngeal carcinoma-associated gene 20 protein
• UAP
• UBAP
• UBAP-1
• ubiquitin associated protein 1
• ubiquitin associated protein
• ubiquitin-associated protein 1

Background

UBAP1 is a member of the UBA domain family, whose members include proteins having connections to ubiquitin and the ubiquitination pathway. The ubiquitin associated domain is thought to be a non-covalent ubiquitin binding domain consisting of a compact three helix bundle. This particular protein originates from a gene locus in a refined region on chromosome 9 undergoing loss of heterozygosity in nasopharyngeal carcinoma (NPC). Taking into account its cytogenetic location, this UBA domain family member is being studies as a putative target for mutation in nasopharyngeal carcinomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UBAP1 Antibody (NBP1-80651)(3)

Publications using NBP1-80651

• Zhao D, Gao Y, Su Y et al. Oroxylin A regulates cGAS DNA hypermethylation induced by methionine metabolism to promote HSC senescence Pharmacological Research 2022-12-01 [PMID: 36464146] (ICC/IF)
• Zeng J, Sun Y, Sun S et al. Leveraging Nanodrug Delivery System for Simultaneously Targeting Tumor Cells and M2 Tumor-Associated Macrophages for Efficient Colon Cancer Therapy ACS applied materials & interfaces 2022-11-16 [PMID: 36327132]
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Review for UBAP1 Antibody (NBP1-80651) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 09/07/2015

Summary

• Application: Western Blot
• Sample Tested: Panc-1 and AsPC-1 whole cell lysates
• Species: Human
• Lot: R09662

Bioinformatics

• Gene Symbol: UBAP1
• Entrez:
  • 51271(Human)