PHACS Antibody

Images

 
Western Blot: PHACS Antibody [NBP1-90260] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: PHACS Antibody [NBP1-90260] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: PHACS Antibody [NBP1-90260] - Staining of human tonsil shows strong cytoplasmic positivity.
Western Blot: PHACS Antibody [NBP1-90260] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHACS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYLPKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACCS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PHACS Protein (NBP1-90260PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHACS Antibody

  • 1-aminocyclopropane-1-carboxylate synthase homolog(Arabidopsis)(non-functional)
  • 1-aminocyclopropane-1-carboxylate synthase-like protein 1
  • PHACSACSACC synthase-like protein 1

Background

Does not catalyze the synthesis of 1-aminocyclopropane-1-carboxylate but is capable of catalyzing thedeamination of L-vinylglycine

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DCRP00
Species: Hu
Applications: ELISA
MAB1266
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF5739
Species: Hu, Mu, Rt
Applications: WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
NB100-56561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
D6050
Species: Hu
Applications: ELISA
DKK300
Species: Hu
Applications: ELISA
210-TA
Species: Hu
Applications: BA
NBP3-15744
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-59645
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
DCDL40
Species: Hu
Applications: ELISA
NBP1-89270
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3667
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-90260
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PHACS Antibody (NBP1-90260) (0)

There are no publications for PHACS Antibody (NBP1-90260).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHACS Antibody (NBP1-90260) (0)

There are no reviews for PHACS Antibody (NBP1-90260). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PHACS Antibody (NBP1-90260) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHACS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACCS