PHACS Antibody


Western Blot: PHACS Antibody [NBP1-90260] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: PHACS Antibody [NBP1-90260] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: PHACS Antibody [NBP1-90260] - Staining of human tonsil shows strong cytoplasmic positivity.
Western Blot: PHACS Antibody [NBP1-90260] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human more

Product Details

Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PHACS Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYLPKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPG
Specificity of human, mouse, rat PHACS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PHACS Protein (NBP1-90260PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PHACS Antibody

  • 1-aminocyclopropane-1-carboxylate synthase homolog(Arabidopsis)(non-functional)
  • 1-aminocyclopropane-1-carboxylate synthase-like protein 1
  • PHACSACSACC synthase-like protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PHACS Antibody (NBP1-90260) (0)

There are no publications for PHACS Antibody (NBP1-90260).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHACS Antibody (NBP1-90260) (0)

There are no reviews for PHACS Antibody (NBP1-90260). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PHACS Antibody (NBP1-90260) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PHACS Antibody and receive a gift card or discount.


Gene Symbol ACCS