U2AF2 Antibody - BSA Free

Western Blot: U2AF2 Antibody [NBP2-58989] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: U2AF2 Antibody [NBP2-58989] - Staining of human cell line HEK 293 shows localization to nuclear speckles.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

U2AF2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit U2AF2 Antibody - BSA Free (NBP2-58989) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-U2AF2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEA
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: U2AF2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  U2AF2 Recombinant Protein Antigen (NBP2-58989PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for U2AF2 Antibody - BSA Free

• hU2AF(65)
• hU2AF65
• splicing factor U2AF 65 kD subunit
• splicing factor U2AF 65 kDa subunit
• U2 (RNU2) small nuclear RNA auxiliary factor 2
• U2 auxiliary factor 65 kDa subunit
• U2 small nuclear ribonucleoprotein auxiliary factor (65kD)
• U2 small nuclear RNA auxiliary factor 2
• U2AF65U2 snRNP auxiliary factor large subunit

Background

U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly. Multiple transcript variants have been detected for this gene, but the full-length natures of only two have been determined to date. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for U2AF2 Antibody (NBP2-58989)(1)

Publication using NBP2-58989

• Chen W, Pilling D, Gomer RH The mRNA binding protein DDX3 mediates TGF-?1 upregulation of translation and promotes pulmonary fibrosis JCI insight 2023-02-23 [PMID: 36821384] (WB, Human)

Bioinformatics

• Gene Symbol: U2AF2