U2AF2 Antibody (8E8R9)

Western Blot: U2AF2 Antibody (8E8R9) [NBP3-16432] - Western blot analysis of extracts of various cell lines, using U2AF2/U2AF2 Rabbit mAb (NBP3-16432) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry of paraffin-embedded human colon using U2AF2/U2AF2 Rabbit mAb (NBP3-16432) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Western Blot: U2AF2 Antibody (8E8R9) [NBP3-16432] - Western blot analysis of extracts of various cell lines, using U2AF2/U2AF2 Rabbit mAb (NBP3-16432) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunoprecipitation: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug U2AF2 antibody (NBP3-16432). Western blot was performed from the immunoprecipitate using U2AF2 antibody (NBP3-16432) at a dilition of 1:1000.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [NBP3-16432] - Immunohistochemistry analysis of paraffin-embedded Rat heart tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [U2AF2] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [U2AF2] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [U2AF2] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [U2AF2] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [U2AF2] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [U2AF2] - Immunohistochemistry analysis of paraffin-embedded Rat heart tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [U2AF2] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [U2AF2] - Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: U2AF2 Antibody (8E8R9) [U2AF2] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using U2AF2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IP
• Clone: 8E8R9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

U2AF2 Antibody (8E8R9) Summary

• Description: Novus Biologicals Rabbit U2AF2 Antibody (8E8R9) (NBP3-16432) is a recombinant monoclonal antibody validated for use in IHC, WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 376-475 of human U2AF2 (P26368). EVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: U2AF2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for U2AF2 Antibody (8E8R9)

• hU2AF(65)
• hU2AF65
• splicing factor U2AF 65 kD subunit
• splicing factor U2AF 65 kDa subunit
• U2 (RNU2) small nuclear RNA auxiliary factor 2
• U2 auxiliary factor 65 kDa subunit
• U2 small nuclear ribonucleoprotein auxiliary factor (65kD)
• U2 small nuclear RNA auxiliary factor 2
• U2AF65U2 snRNP auxiliary factor large subunit

Background

U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly. Multiple transcript variants have been detected for this gene, but the full-length natures of only two have been determined to date. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: U2AF2