TYRP1 Antibody (CL4917)

Images

 
Western Blot: TYRP1 Antibody (CL4917) [NBP2-61147] - Western blot analysis in human cell line SK-MEL-30.
Immunocytochemistry/ Immunofluorescence: TYRP1 Antibody (CL4917) [NBP2-61147] - Staining of SK-MEL-30 cells using the Anti-TYRP1 monoclonal antibody, showing specific staining in the vesicles in green. Microtubule- and ...read more
Immunohistochemistry: TYRP1 Antibody (CL4917) [NBP2-61147] - Immunohistochemical staining of human skeletal muscle shows no positivity in muscle fibers as expected (negative control).
Immunohistochemistry: TYRP1 Antibody (CL4917) [NBP2-61147] - Immunohistochemical staining of human skin shows strong cytoplasmic immunoreactivity in melanocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clone
CL4917
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TYRP1 Antibody (CL4917) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLH
Epitope
YSDPTGKYDP
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
TYRP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for TYRP1 Antibody (CL4917)

  • b-PROTEIN
  • CAS25,6-dihydroxyindole-2-carboxylic acid oxidase
  • Catalase B
  • CATB
  • EC 1.14.18
  • EC 1.14.18.-
  • EC 1.14.18.1
  • Glycoprotein 75
  • GP75DHICA oxidase
  • Melanoma antigen gp75
  • TRP-1
  • TRPTYRP
  • tyrosinase-related protein 1TRP1
  • TYRRP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86893
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1617
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB110-40763
Species: Gp, Hu, Mu, Rt, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-56561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-97311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB110-74960
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77262
Species: Hu, Mu
Applications: ELISA, IF, IHC, IHC-P, WB
NBP1-77260
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
664-LI/CF
Species: Hu
Applications: BA
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-98844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-20989
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-61147
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TYRP1 Antibody (NBP2-61147) (0)

There are no publications for TYRP1 Antibody (NBP2-61147).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TYRP1 Antibody (NBP2-61147) (0)

There are no reviews for TYRP1 Antibody (NBP2-61147). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TYRP1 Antibody (NBP2-61147) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TYRP1 Products

Bioinformatics Tool for TYRP1 Antibody (NBP2-61147)

Discover related pathways, diseases and genes to TYRP1 Antibody (NBP2-61147). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TYRP1 Antibody (NBP2-61147)

Discover more about diseases related to TYRP1 Antibody (NBP2-61147).
 

Pathways for TYRP1 Antibody (NBP2-61147)

View related products by pathway.

PTMs for TYRP1 Antibody (NBP2-61147)

Learn more about PTMs related to TYRP1 Antibody (NBP2-61147).

Blogs on TYRP1.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TYRP1 Antibody (CL4917) and receive a gift card or discount.

Bioinformatics

Gene Symbol TYRP1