Home » TYRP1 » TYRP1 Antibodies » TYRP1 Antibody (CL4917)

TYRP1 Antibody (CL4917)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: TYRP1 Antibody (CL4917) [NBP2-61147] - Western blot analysis in human cell line SK-MEL-30.
Western Blot: TYRP1 Antibody (CL4917) [NBP2-61147] - Western blot analysis in human cell line SK-MEL-30.
Immunocytochemistry/ Immunofluorescence: TYRP1 Antibody (CL4917) [NBP2-61147] - Staining of SK-MEL-30 cells using the Anti-TYRP1 monoclonal antibody, showing specific staining in the vesicles in green. Microtubule- and ...read more
Immunohistochemistry: TYRP1 Antibody (CL4917) [NBP2-61147] - Immunohistochemical staining of human skeletal muscle shows no positivity in muscle fibers as expected (negative control).
Immunohistochemistry: TYRP1 Antibody (CL4917) [NBP2-61147] - Immunohistochemical staining of human skin shows strong cytoplasmic immunoreactivity in melanocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clone
CL4917
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TYRP1 Antibody (CL4917) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLH
Epitope
YSDPTGKYDP
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
TYRP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for TYRP1 Antibody (CL4917)

  • b-PROTEIN
  • CAS25,6-dihydroxyindole-2-carboxylic acid oxidase
  • Catalase B
  • CATB
  • EC 1.14.18
  • EC 1.14.18.-
  • EC 1.14.18.1
  • Glycoprotein 75
  • GP75DHICA oxidase
  • Melanoma antigen gp75
  • TRP-1
  • TRPTYRP
  • tyrosinase-related protein 1TRP1
  • TYRRP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in A431 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in MCF-7 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Analysis of paraffin-embedded human liver tissue using anti-Tyrosinase antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TRP2 Antibody
NBP1-86893
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Analysis in human skin and lymph node tissues. Corresponding DCT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Staining of human skin shows cytoplasmic positivity in squamous epithelial cells.
Western Blot: TRP2 Antibody [NBP1-86893] - Analysis in human cell line SK-MEL-30 and human cell line U-2 OS.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Vanilloid R1/TRPV1
Antibody
NB100-1617
Immunocytochemistry/Immunofluorescence: Vanilloid R1/TRPV1 Antibody [NB100-1617] - TRPV1 staining in rat trigeminal ganglion. Image courtesy of Dr. Norman Capra, University of Maryland
Western Blot: Vanilloid R1/TRPV1 Antibody [NB100-1617] - Nociceptive behavior and CBS, TRPA1, TRPC6 and TRPV1 protein expression of the dorsal root ganglia obtained from normoglycemic and diabetic rats at 21 days post-streptozotocin injection. TRPV1 protein expression in normoglycemic and diabetic rats 21 days after streptozotocin injection. Data were normalized against Beta-actin and are expressed as the mean?+-?SEM of 5-6 animals. *Significantly different from control or normoglycemic (NG) group, #significantly different from vehicle (Veh, diabetic rats) group and &significantly different from SKF-96365 (SKF) group (P?<?0.05) determined by one-way ANOVA followed by the Student-Newman-Keuls' test Image collected and cropped by CiteAb from the following publication (https://bmcneurosci.biomedcentral.com/articles/10.1186/s12868-018-0483-3) licensed under a CC-BY licence.
Immunohistochemistry: Vanilloid R1/TRPV1 Antibody [NB100-1617] - TRPV1 Antibody [NB100-1617] - Dorsal Root Ganglion
(25 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
TRPA1 Antibody -
BSA Free
NB110-40763
Immunocytochemistry/Immunofluorescence: TRPA1 Antibody [NB110-40763] - Analysis of TRPA1 in HEK 293 cells (Flp In Trex system) cells.
Immunohistochemistry: TRPA1 Antibody [NB110-40763] - Staining TRPA1 in mouse intestine.
Flow Cytometry: TRPA1 Antibody [NB110-40763] - An intracellular stain was performed on A549 cells with NB110-40763C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(2 Reviews)
(51 Publications)
Species: Gp, Hu, Mu, Rt, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
MITF Antibody
(21D1418) - BSA Free
NB100-56561
Immunohistochemistry-Paraffin: MITF Antibody (21D1418) [NB100-56561] - Analysis of a FFPE tissue section of human skin using 1:200 dilution of MITF (21D1418) antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. General cytoplasmic staining appears enriched in melanocytes below the epidermis. Some nuclear reactivity is observed as well.
Immunocytochemistry/Immunofluorescence: MITF Antibody (21D1418) [NB100-56561] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-MITF Antibody (21D1418) NB100-56561 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution for 60 minutes. Cells were imaged using a 100X objective and digitally deconvolved.
Western Blot: MITF Antibody (21D1418) [NB100-56561] - Analysis of HeLa lysate (35ug per lane, RIPA buffer) using MiTF antibody (NB100-56561) at 0.1ug/ml. Band detected at ~60kDa. (Expected MW of 58.2kDa according to NP_937802.1).
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded breast tissue using anti-PMEL17/SILV mouse monoclonal antibody.
(1 Review)
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(5 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry: POMC Antibody [NB100-1533] - Representative immunofluorescence images of (B) POMC as a prohormone (n = 5-6 each) in the ARC of mice approximately 5 to 10 weeks of age. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
TRPM8 Antibody -
BSA Free
NBP1-97311
Western Blot: TRPM8 Antibody [NBP1-97311] - Analysis of TRPM8 in PC12 cell lysate.
Immunocytochemistry/Immunofluorescence: TRPM8 Antibody [NBP1-97311] - TRPM8 antibody was tested in U2OS cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: TRPM8 Antibody [NBP1-97311] - Analysis of TRPM8 in mouse prostate using DAB with hematoxylin counterstain.
(8 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
TRPV4 Antibody
NB110-74960
Immunohistochemistry-Paraffin: TRPV4 Antibody [NB110-74960] - Rat kidney using Rabbit antibody to TRPV4, dilution 1: 1000, incubated 30 min at RT (using Autostainer)
Immunohistochemistry-Paraffin: TRPV4 Antibody [NB110-74960] - Rat kidney using Rabbit antibody to TRPV4, dilution 1: 1000, incubated 30 min at RT (using Autostainer).
Western Blot: TRPV4 Antibody [NB110-74960] - WB on mouse brain lysate (reduced, denatured) using Rabbit antibody to TRPV4 at 1 : 1000 dilution.
(4 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TRPC3 Antibody -
BSA Free
NBP1-77262
Immunofluorescence: TRPC3 Antibody [NBP1-77262] - Mouse Heart cells with TRPC3 antibody at 20 ug/mL.
Immunohistochemistry-Paraffin: TRPC3 Antibody [NBP1-77262] - Mouse heart tissue with TRPC3 antibody at 2 ug/mL.
Western Blot: TRPC3 Antibody [NBP1-77262] - Human brain tissue lysate. (A) 1 and (B) 2 ug/mL.
Species: Hu, Mu
Applications: ELISA, IF, IHC, IHC-P, WB
TRPC6 Antibody -
BSA Free
NBP1-77260
Immunohistochemistry-Paraffin: TRPC6 Antibody [NBP1-77260] - Mouse lung tissue with TRPC6 antibody at 10 ug/ml.
Western Blot: TRPC6 Antibody [NBP1-77260] - Mouse lung tissue lysate with TRPC6 antibody at (A) 0.5, (B) 1 and (C) 2 ug/ml.
Immunocytochemistry/Immunofluorescence: TRPC6 Antibody [NBP1-77260] - Immunofluorescence of TRPC6 in Mouse Lung cells with TRPC6 antibody at 20 ug/mL.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(18 Publications)
Species: Hu
Applications: BA
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(15 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
TRPC1 Antibody
NB100-98844
Immunocytochemistry/Immunofluorescence: TRPC1 Antibody [NB100-98844] - IF (confocal) on rat brain at 1:500 dilution using Rabbit antibody to 2d extracellular loop of TRPC1: whole serum, DAPI counterstained appearing in blue.
Immunocytochemistry/Immunofluorescence: TRPC1 Antibody [NB100-98844] - IF (confocal) on rat olfactory bulb at 1:500 dilution using Rabbit antibody to TRPC1: whole serum, DAPI counterstained appearing in blue.
Immunocytochemistry/Immunofluorescence: TRPC1 Antibody [NB100-98844] - IF (confocal) on rat brain at 1:500 dilution using Rabbit antibody to 2d extracellular loop of TRPC1: whole serum, DAPI counterstained appearing in blue.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
TRPC4 Antibody
NBP1-20989
Immunohistochemistry-Paraffin: TRPC4 Antibody [NBP1-20989] - Staining of paraffin embedded Human Kidney with antibody at 4.75 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: TRPC4 Antibody [NBP1-20989] - Staining of paraffin embedded Human Placenta with antibody at 4.75 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: TRPC4 Antibody [NBP1-20989] - Staining of Rat Brain lysate (35 ug protein in RIPA buffer) with antibody at 0.3 ug/mL. Primary incubation was 1 hour. Detected by chemiluminescence.
(2 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
TRPM2 Antibody -
BSA Free
NB110-81601
Immunocytochemistry/Immunofluorescence: TRPM2 Antibody [NB110-81601] - Neuro2a cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-TRPM2 at 5 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: TRPM2 Antibody [NB110-81601] - Staining of rat hippocampus using NB110-81601. TRPM2 is stained red, GFAP is stained green and nuclei staining is blue. Photo courtesy of Dr. Ji-Zhong Bai, The University of Auckland, New Zealand.
Western Blot: TRPM2 Antibody [NB110-81601] - Lane 1: CHO cells untransfected. Lane 2: CHO cell transfected with rat TRPM2 Lane 3: Mouse cortical neurons (cultured) Photo courtesy of Dr. Paco Herson, Oregon Health & Science University.
(10 Publications)
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
TYRP1 Antibody
(CL4917)
NBP2-61147
TYRP1 Antibody (CL4917)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TYRP1 Antibody (NBP2-61147) (0)

There are no publications for TYRP1 Antibody (NBP2-61147).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TYRP1 Antibody (NBP2-61147) (0)

There are no reviews for TYRP1 Antibody (NBP2-61147). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TYRP1 Antibody (NBP2-61147) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TYRP1 Products

Bioinformatics Tool for TYRP1 Antibody (NBP2-61147)

Discover related pathways, diseases and genes to TYRP1 Antibody (NBP2-61147). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TYRP1 Antibody (NBP2-61147)

Discover more about diseases related to TYRP1 Antibody (NBP2-61147).
 

Pathways for TYRP1 Antibody (NBP2-61147)

View related products by pathway.

PTMs for TYRP1 Antibody (NBP2-61147)

Learn more about PTMs related to TYRP1 Antibody (NBP2-61147).

Blogs on TYRP1.

Check out the latest blog posts on TYRP1.
Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TYRP1 Antibody (CL4917) and receive a gift card or discount.


Bioinformatics

Gene Symbol TYRP1