Twist-1 Antibody


Western Blot: Twist-1 Antibody [NB120-49254] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml
Immunohistochemistry-Paraffin: Twist-1 Antibody [NB120-49254] - Human Uterus Tissue, 4-8ug/ml.
Western Blot: Twist-1 Antibody [NB120-49254] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Twist-1 Antibody Summary

A synthetic peptide corresponding to a region of human TWIST1 with an internal ID of P20171. Peptide sequence DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
WB: Use at a concentration of 2.5
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
Jurkat Lysate (NB800-PC2)
Read Publication using
NB120-49254 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Twist-1 Antibody

  • acrocephalosyndactyly 3
  • ACS3
  • B-HLH DNA binding protein
  • BHLHA38
  • bHLHa38BPES3
  • BPES3
  • Class A basic helix-loop-helix protein 38
  • CRS1
  • H-twist
  • H-twistblepharophimosis, epicanthus inversus and ptosis 3
  • twist homolog 1 (Drosophila)
  • TWIST homolog of drosophila
  • Twist1
  • Twist-1
  • twist-related protein 1


Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. TWIST1 is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue, in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, Simple Western, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP, MiAr
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Twist-1 Antibody (NB120-49254)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Twist-1 Antibody (NB120-49254) (0)

There are no reviews for Twist-1 Antibody (NB120-49254). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Twist-1 Antibody (NB120-49254) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Twist-1 Products

Bioinformatics Tool for Twist-1 Antibody (NB120-49254)

Discover related pathways, diseases and genes to Twist-1 Antibody (NB120-49254). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Twist-1 Antibody (NB120-49254)

Discover more about diseases related to Twist-1 Antibody (NB120-49254).

Pathways for Twist-1 Antibody (NB120-49254)

View related products by pathway.

PTMs for Twist-1 Antibody (NB120-49254)

Learn more about PTMs related to Twist-1 Antibody (NB120-49254).

Research Areas for Twist-1 Antibody (NB120-49254)

Find related products by research area.

Blogs on Twist-1.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Twist-1 Antibody and receive a gift card or discount.


Gene Symbol TWIST1