Twist-1 Antibody

Images

 
Western Blot: Twist-1 Antibody [NB120-49254] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml
Immunohistochemistry-Paraffin: Twist-1 Antibody [NB120-49254] - Human Uterus Tissue, 4-8ug/ml.
Western Blot: Twist-1 Antibody [NB120-49254] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Twist-1 Antibody Summary

Immunogen
A synthetic peptide corresponding to a region of human TWIST1 with an internal ID of P20171. Peptide sequence DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW.
Specificity
TWIST1
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TWIST1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
WB: Use at a concentration of 2.5
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
Jurkat Lysate (NB800-PC2)
Publications
Read Publication using
NB120-49254 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Twist-1 Antibody

  • acrocephalosyndactyly 3
  • ACS3
  • B-HLH DNA binding protein
  • BHLHA38
  • bHLHa38BPES3
  • BPES3
  • Class A basic helix-loop-helix protein 38
  • CRS1
  • H-twist
  • H-twistblepharophimosis, epicanthus inversus and ptosis 3
  • SCSBPES2
  • twist homolog 1 (Drosophila)
  • TWIST homolog of drosophila
  • TWIST
  • Twist1
  • Twist-1
  • twist-related protein 1

Background

Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. TWIST1 is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue, in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00117581-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-27184
Species: Hu, Mu, Ca, Eq
Applications: WB, ICC/IF
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB120-49254
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Twist-1 Antibody (NB120-49254)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for Twist-1 Antibody (NB120-49254) (0)

There are no reviews for Twist-1 Antibody (NB120-49254). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Twist-1 Antibody (NB120-49254) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Twist-1 Products

Bioinformatics Tool for Twist-1 Antibody (NB120-49254)

Discover related pathways, diseases and genes to Twist-1 Antibody (NB120-49254). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Twist-1 Antibody (NB120-49254)

Discover more about diseases related to Twist-1 Antibody (NB120-49254).
 

Pathways for Twist-1 Antibody (NB120-49254)

View related products by pathway.

PTMs for Twist-1 Antibody (NB120-49254)

Learn more about PTMs related to Twist-1 Antibody (NB120-49254).
 

Research Areas for Twist-1 Antibody (NB120-49254)

Find related products by research area.

Blogs on Twist-1.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Twist-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TWIST1
Entrez