Twist-2 Antibody (3C8)

Images

 
Western Blot: Twist-2 Antibody (3C8) [H00117581-M01] - Analysis of TWIST2 expression in transfected 293T cell line by TWIST2 monoclonal antibody (M01), clone 3C8.Lane 1: TWIST2 transfected lysate(18.1 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: Twist-2 Antibody (3C8) [H00117581-M01] - Analysis of monoclonal antibody to TWIST2 on formalin-fixed paraffin-embedded human adrenal gland. Antibody concentration 3 ug/ml.
Immunohistochemistry-Paraffin: Twist-2 Antibody (3C8) [H00117581-M01] - Immunoperoxidase of monoclonal antibody to TWIST2 ( Cat # H00117581-M01 ) on formalin-fixed paraffin-embedded human liver. [antibody concentration ...read more
ELISA: Twist-2 Antibody (3C8) [H00117581-M01] - Detection limit for recombinant GST tagged TWIST2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
Clone
3C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Twist-2 Antibody (3C8) Summary

Immunogen
TWIST2 (AAH33168, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH
Specificity
TWIST2 - twist homolog 2 (Drosophila)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TWIST2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publications using
H00117581-M01 in the following applications:

  • IHC
    2 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Twist-2 Antibody (3C8)

  • bHLHa39
  • bHLHa39twist-related bHLH protein Dermo1
  • Class A basic helix-loop-helix protein 39
  • Dermis-expressed protein 1
  • DERMO1
  • Dermo-1
  • DERMO1MGC117334
  • twist homolog 2 (Drosophila)
  • Twist2
  • Twist-2
  • twist-related protein 2

Background

Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Twist. It is thought that during osteoblast development this protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37364
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-69368
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-37578
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-03886
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-82991
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-05987
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, IP, KD, MiAr, Simple Western, Single-Cell Western, WB
NBP1-77461
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
DMP900
Species: Hu
Applications: ELISA
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
NBP2-27293
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
NBP2-45831
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-00932
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for Twist-2 Antibody (H00117581-M01)(10)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(2)
All Applications
Filter By Species
Human
(2)
All Species
Showing Publications 1 - 10 of 10.
Publications using H00117581-M01 Applications Species
Singh M, Venugopal C, Tokar T et al. RNAi screen identifies essential regulators of human brain metastasis-initiating cells. Acta Neuropathol 2017 Aug 1 [PMID: 28766011]
Oh S, Oh J, Lee C et al. Expression of Twist2 is controlled by T-cell receptor signaling and determines the survival and death of thymocytes. Cell Death Differ 2016 Jul 8 [PMID: 27391798]
Rodrigues IS, Lavorato-Rocha AM, de M Maia B et al. Epithelial-mesenchymal transition-like events in vulvar cancer and its relation with HPV. Br J Cancer. 2013 Jun 18 [PMID: 23778524]
Yu H, Jin GZ, Liu K et al. Twist2 is a valuable prognostic biomarker for colorectal cancer. World J Gastroenterol. 2013 Apr 21 [PMID: 23613636] (IHC, Human) IHC Human
Mao Y, Zhang N, Xu J et al. Significance of heterogeneous twist2 expression in human breast cancers. PLoS One. 2012 Oct 25 [PMID: 23133563]
Plasilova M, Chattopadhyay C, Ghosh A et al. Discordant Gene Expression Signatures and Related Phenotypic Differences in Lamin A-and A/C-Related Hutchinson-Gilford Progeria Syndrome (HGPS). PLoS One. 2011 Jun 27 [PMID: 21738662]
Carvalho ST, Stiepcich MM, Fregnani JH et al. Evaluation of prognostic factors in stage IIA breast tumors and their correlation with mortality risk Clinics (Sao Paulo) 2011 [PMID: 21655754] (IHC, Human) IHC Human
Fang X, Cai Y, Liu J et al. Twist2 contributes to breast cancer progression by promoting an epithelial-mesenchymal transition and cancer stem-like cell self-renewal. Oncogene. 2011 May 23 [PMID: 21602879]
Doreau A, Belot A, Bastid J et al. Interleukin 17 acts in synergy with B cell-activating factor to influence B cell biology the pathophysiology of systemic lupus erythematosus. Nat Immunol 10(7):778-85. 2009 Jul. [PMID: 19483719]
Murakami M, Ohkuma M, Nakamura M. Molecular mechanism of transforming growth factor-beta-mediated inhibition of growth arrest differentiation in a myoblast cell line. Dev Growth Differ;50(2):121-30. 2008 Feb. [PMID: 18211587]

Reviews for Twist-2 Antibody (H00117581-M01) (0)

There are no reviews for Twist-2 Antibody (H00117581-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for Twist-2 Antibody (H00117581-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Twist-2 Products

Bioinformatics Tool for Twist-2 Antibody (H00117581-M01)

Discover related pathways, diseases and genes to Twist-2 Antibody (H00117581-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Twist-2 Antibody (H00117581-M01)

Discover more about diseases related to Twist-2 Antibody (H00117581-M01).
 

Pathways for Twist-2 Antibody (H00117581-M01)

View related products by pathway.

PTMs for Twist-2 Antibody (H00117581-M01)

Learn more about PTMs related to Twist-2 Antibody (H00117581-M01).
 

Research Areas for Twist-2 Antibody (H00117581-M01)

Find related products by research area.

Blogs on Twist-2

There are no specific blogs for Twist-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Twist-2 Antibody (3C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol TWIST2
Entrez
OMIM
Uniprot