TWEAK R/TNFRSF12 Antibody (1G4T3) Summary
| Description |
Novus Biologicals Rabbit TWEAK R/TNFRSF12 Antibody (1G4T3) (NBP3-16621) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 50-129 of human TWEAK R/TNFRSF12 (Q9NP84). MDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
TNFRSF12A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TWEAK R/TNFRSF12 Antibody (1G4T3)
Background
TWEAK (otherwise known as TNFRSF12A, Tumor necrosis factor receptor superfamily member 12A), is a member of the TNF family and was first described as a weak inducer of apoptosis in some cell types. It is thought to promote angiogenesis and the proliferation of endothelial cells as well as modulating cellular adhesion to matrix proteins. Recently, a receptor for TWEAK was isolated by expression cloning from a HUVEC cell cDNA library.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: BA
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
Species: Hu, Mu
Applications: WB, ICC/IF
Publications for TWEAK R/TNFRSF12 Antibody (NBP3-16621) (0)
There are no publications for TWEAK R/TNFRSF12 Antibody (NBP3-16621).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TWEAK R/TNFRSF12 Antibody (NBP3-16621) (0)
There are no reviews for TWEAK R/TNFRSF12 Antibody (NBP3-16621).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TWEAK R/TNFRSF12 Antibody (NBP3-16621) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TWEAK R/TNFRSF12 Products
Research Areas for TWEAK R/TNFRSF12 Antibody (NBP3-16621)
Find related products by research area.
|
Blogs on TWEAK R/TNFRSF12