TSPAN3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TSPAN3 Antibody [NBP1-80677] - Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TSPAN3 Antibody [NBP1-80677] - Staining of human hippocampus shows strong cytoplasmic positivity in both neuronal cells and glial cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TSPAN3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TSPAN3 Antibody - BSA Free (NBP1-80677) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-TSPAN3 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQEI
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSPAN3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TSPAN3 Protein (NBP1-80677PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TSPAN3 Antibody - BSA Free

• tetraspan TM4SF
• tetraspanin 3
• Tetraspanin TM4-A
• tetraspanin-3
• TM4A
• TM4-A
• TM4SF8
• Transmembrane 4 superfamily member 8tetraspan 3
• TSPAN3
• TSPAN-3

Background

The protein encoded by the Tetraspanin-3 gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TSPAN3 Antibody (NBP1-80677)(2)

Publications using NBP1-80677

• Kumar S, Fan X, Milo Rasouly H et al. ZEB2 controls kidney stromal progenitor differentiation and inhibits abnormal myofibroblast expansion and kidney fibrosis JCI insight 2022-11-29 [PMID: 36445780] (ICC/IF, Mouse)
• Vohwinkel CU, Burns N, Coit E et al. HIF1A-dependent induction of alveolar epithelial PFKFB3 dampens acute lung injury JCI insight 2022-11-03 [PMID: 36326834] (WB, Mouse)

Bioinformatics

• Gene Symbol: TSPAN3
• Entrez:
  • 10099(Human)
• Uniprot:
  • O60637(Human)