DYNC1H1 Antibody

Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining in human cerebral cortex and pancreas tissues using anti-DYNC1H1 antibody. Corresponding DYNC1H1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DYNC1H1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQR
• Predicted Species: Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DYNC1H1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. WB, ICC/IF reported in scientific literature (PMID: 25383660).
• Control Peptide:

  DYNC1H1 Protein (NBP1-84254PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25383660).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DYNC1H1 Antibody

• cytoplasmic dynein 1 heavy chain 1
• Cytoplasmic dynein heavy chain 1
• DHC1a
• DHC1Dynein heavy chain, cytosolic
• DKFZp686P2245
• Dnchc1
• DNCLDNCH1
• DNECLDYHC
• dynein, cytoplasmic 1, heavy chain 1
• dynein, cytoplasmic, heavy polypeptide 1
• HL-3
• KIAA0325
• p22

Background

The DYNC1H1 gene encodes a cytoplasmic dynein 1 heavy chain 1 protein that is 4,646 amino acids long at 532 kDA. Dyneines function as molecular motors that contain ATPase activity. Defects in DYNC1H1 cause Charcot-Marie-Tooth Disease type 2O (CMT2O), mental retardation autosomal dominant type 13 (MRD13), as well as spinal muscular atrophy, lower extremity, autosomal dominant (SMALED). DYNC1H1 has also been investigated by researchers in myeloma, neuropathy, ciliary dyskinesia, lateral sclerosis, intellectual disabilities, lissencephaly, schizophrenia, malaria, and neurodegeneration. DYNC1H1 participates in centrosome maturation, adaptive immune system, cytoplasmic microtubules, cell cycle spindle assembly and chromosome separation, as well as phagosome and vasopressin-regulated water reabsorption. DYNC1H1 interacts with genes HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H43.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DYNC1H1 Antibody (NBP1-84254)(1)

Publication using NBP1-84254

• Marin Barisic, Paulo Aguiar, Stephan Geley et al. Kinetochore motors drive congression of peripheral polar chromosomes by overcoming random arm-ejection forces. Nature Cell Biology 2014-11-10 [PMID: 25383660] (WB, ICC/IF, Human)

Bioinformatics

• Gene Symbol: DYNC1H1