Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody

Images

 
Western Blot: Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody [NBP1-85273] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody [NBP1-85273] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody [NBP1-85273] - Staining in human kidney and skin tissues using anti-DDAH1 antibody. Corresponding ...read more
Western Blot: Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody [NBP1-85273] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody [NBP1-85273] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody [NBP1-85273] - Staining of human skin shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLT
Specificity
Specificity of human, mouse, rat Dimethylarginine Dimethylaminohydrolase 1/DDAH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDAH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Protein (NBP1-85273PEP)
Publications
Read Publication using
NBP1-85273 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 22440215).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody

  • DDAH1
  • DDAH-1
  • DDAHdimethylargininase-1
  • DDAHI
  • Dimethylargininase-1
  • dimethylarginine dimethylaminohydrolase 1FLJ25539
  • EC 3.5.3.18
  • FLJ21264
  • N(G)
  • N(G)-dimethylarginine dimethylaminohydrolase 1
  • NG, NG-dimethylarginine dimethylaminohydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-86092
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67074
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-43312
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
NBP2-67560
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-A9033A-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
MAB7947
Species: Hu, Mu, Rt
Applications: IHC

Publications for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP1-85273)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP1-85273) (0)

There are no reviews for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP1-85273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP1-85273) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP1-85273)

Discover related pathways, diseases and genes to Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP1-85273). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP1-85273)

Discover more about diseases related to Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP1-85273).
 

Pathways for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP1-85273)

View related products by pathway.

PTMs for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP1-85273)

Learn more about PTMs related to Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP1-85273).
 

Research Areas for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (NBP1-85273)

Find related products by research area.

Blogs on Dimethylarginine Dimethylaminohydrolase 1/DDAH1

There are no specific blogs for Dimethylarginine Dimethylaminohydrolase 1/DDAH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDAH1
Entrez