RCN2 Antibody - BSA Free

Western Blot: RCN2 Antibody [NBP2-32011] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue

Immunocytochemistry/Immunofluorescence: RCN2 Antibody [NBP2-32011] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011] - Staining of human epididymis shows high expression.

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011] - Staining in human epididymis and pancreas tissues using anti-RCN2 antibody. Corresponding RCN2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011] - Staining of human cerebral cortex, epididymis, pancreas and testis using Anti-RCN2 antibody NBP2-32011 (A) shows similar protein distribution across tissues to independent antibody NBP2-32010 (B).

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011] - Staining of human testis.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RCN2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VTWDEYNIQMYDRVIDFDENTALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEF
• Predicted Species: Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RCN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RCN2 Protein (NBP2-32011PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RCN2 Antibody - BSA Free

• Calcium-binding protein ERC-55
• E6BPreticulocalbin 2, EF-hand calcium binding domain (endoplasmic reticulumcalcium-binding protein, 55kD)
• ERC-55
• ERC55E6-binding protein
• reticulocalbin 2, EF-hand calcium binding domain
• reticulocalbin-2
• TCBP49

Background

Reticulocalbin 2 is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. The RCN2 gene maps to the same region as type 4 Bardet-Biedl syndrome (MIM:600374), suggesting a possible causative role for reticulocalbin 2 in the disorder. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RCN2
• Uniprot:
  • Q14257(Human)