RCN2 Antibody

Images

 
Western Blot: RCN2 Antibody [NBP2-32011] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: RCN2 Antibody [NBP2-32011] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RCN2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VTWDEYNIQMYDRVIDFDENTALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RCN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RCN2 Protein (NBP2-32011PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RCN2 Antibody

  • Calcium-binding protein ERC-55
  • E6BPreticulocalbin 2, EF-hand calcium binding domain (endoplasmic reticulumcalcium-binding protein, 55kD)
  • ERC-55
  • ERC55E6-binding protein
  • reticulocalbin 2, EF-hand calcium binding domain
  • reticulocalbin-2
  • TCBP49

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-240
Species: Hu, Mu
Applications: WB, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-90348
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47284
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83483
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4409
Species: Mu
Applications: WB
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF4414
Species: Hu
Applications: WB, IHC
MAB533
Species: Mu
Applications: WB, Neut
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for RCN2 Antibody (NBP2-32011) (0)

There are no publications for RCN2 Antibody (NBP2-32011).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RCN2 Antibody (NBP2-32011) (0)

There are no reviews for RCN2 Antibody (NBP2-32011). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RCN2 Antibody (NBP2-32011) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RCN2 Products

Bioinformatics Tool for RCN2 Antibody (NBP2-32011)

Discover related pathways, diseases and genes to RCN2 Antibody (NBP2-32011). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCN2 Antibody (NBP2-32011)

Discover more about diseases related to RCN2 Antibody (NBP2-32011).
 

Pathways for RCN2 Antibody (NBP2-32011)

View related products by pathway.

PTMs for RCN2 Antibody (NBP2-32011)

Learn more about PTMs related to RCN2 Antibody (NBP2-32011).
 

Research Areas for RCN2 Antibody (NBP2-32011)

Find related products by research area.

Blogs on RCN2

There are no specific blogs for RCN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RCN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RCN2
Uniprot