Prohibitin 2 Antibody

Images

 
Western Blot: Prohibitin 2 Antibody [NBP2-13754] - Analysis in human cell line BEWO.
Immunocytochemistry/ Immunofluorescence: Prohibitin 2 Antibody [NBP2-13754] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Prohibitin 2 Antibody [NBP2-13754] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Western Blot: Prohibitin 2 Antibody [NBP2-13754] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Prohibitin 2 Antibody [NBP2-13754] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Prohibitin 2 Antibody [NBP2-13754] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Prohibitin 2 Antibody [NBP2-13754] - Staining of human tonsil shows strong granular cytoplasmic positivity in non-germinal and germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Prohibitin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRA AQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
Prohibitin 2 Protein (NBP2-13754PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Prohibitin 2 Antibody

  • BAP
  • Bap37
  • BCAP37
  • B-cell associated protein
  • D-Prohibitin
  • MGC117268
  • p22
  • PHB2
  • PNAS-141
  • Prohibitin 2
  • prohibitin-2
  • REA
  • REAB-cell receptor-associated protein BAP37
  • Repressor of estrogen receptor activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF5758
Species: Hu
Applications: ICC, IHC, WB
NBP1-40974
Species: Hu
Applications: ELISA, Flow, IHC, IHC-Fr, IP, WB
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-13677
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1904
Species: Hu
Applications: ICC, IHC, WB
MAB7665
Species: Hu
Applications: IHC, WB
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF3470
Species: Hu
Applications: ICC, WB
NBP1-41012
Species: Hu
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
1137-SL
Species: Hu
Applications: BA
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-80467
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00006812-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
H00138428-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-13754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Prohibitin 2 Antibody (NBP2-13754) (0)

There are no publications for Prohibitin 2 Antibody (NBP2-13754).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prohibitin 2 Antibody (NBP2-13754) (0)

There are no reviews for Prohibitin 2 Antibody (NBP2-13754). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Prohibitin 2 Antibody (NBP2-13754) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Prohibitin 2 Products

Bioinformatics Tool for Prohibitin 2 Antibody (NBP2-13754)

Discover related pathways, diseases and genes to Prohibitin 2 Antibody (NBP2-13754). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prohibitin 2 Antibody (NBP2-13754)

Discover more about diseases related to Prohibitin 2 Antibody (NBP2-13754).
 

Pathways for Prohibitin 2 Antibody (NBP2-13754)

View related products by pathway.

PTMs for Prohibitin 2 Antibody (NBP2-13754)

Learn more about PTMs related to Prohibitin 2 Antibody (NBP2-13754).
 

Research Areas for Prohibitin 2 Antibody (NBP2-13754)

Find related products by research area.

Blogs on Prohibitin 2

There are no specific blogs for Prohibitin 2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prohibitin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHB2