TSPAN13 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TSPAN13 Antibody [NBP1-81001] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TSPAN13 Antibody [NBP1-81001] - Staining of human small intestine shows strong membranous positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: TSPAN13 Antibody [NBP1-81001] - Staining of human pancreas cryosection (200x). Ducts are labeled. Image from verified customer review.
Immunohistochemistry-Paraffin: TSPAN13 Antibody [NBP1-81001] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: TSPAN13 Antibody [NBP1-81001] - Staining of human skeletal muscle shows no membranous positivity in striated muscle fibers as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSPAN13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSPAN13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. TSPAN13 antibody validated for ICC/IF from a verified customer review.
Control Peptide
TSPAN13 Protein (NBP1-81001PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-81001 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TSPAN13 Antibody

  • FLJ22934
  • NET-6
  • NET6transmembrane 4 superfamily member tetraspan NET-6
  • Tetraspan NET-6
  • tetraspanin 13
  • TM4SF13
  • Transmembrane 4 superfamily member 13tetraspanin-13
  • TSPAN13
  • TSPAN-13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21792
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
NB500-327
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB
NBP1-69337
Species: Hu
Applications: IHC, IHC-P, WB
1129-ER
Species: Hu
Applications: BA
7268-CT
Species: Hu
Applications: BA
AF650
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-28869
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-13967
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-62311
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NBP3-06254
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
462-TR/CF
Species: Mu
Applications: BA
NBP1-59438
Species: Hu
Applications: IHC, WB
NBP2-20604
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF6739
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-81001
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TSPAN13 Antibody (NBP1-81001) (0)

There are no publications for TSPAN13 Antibody (NBP1-81001).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for TSPAN13 Antibody (NBP1-81001) (1) 51

Average Rating: 5
(Based on 1 review)

Reviews using NBP1-81001:
Filter by Applications
IF
(1)
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunofluorescence TSPAN13 NBP1-81001
Enlarge
5
reviewed by:
Craig Dorrell
IF 05/09/2014
View

Summary

ApplicationImmunofluorescence
LotA60700

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TSPAN13 Antibody (NBP1-81001) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSPAN13 Products

Bioinformatics Tool for TSPAN13 Antibody (NBP1-81001)

Discover related pathways, diseases and genes to TSPAN13 Antibody (NBP1-81001). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSPAN13 Antibody (NBP1-81001)

Discover more about diseases related to TSPAN13 Antibody (NBP1-81001).
 

Pathways for TSPAN13 Antibody (NBP1-81001)

View related products by pathway.

Blogs on TSPAN13

There are no specific blogs for TSPAN13, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Craig Dorrell
05/09/2014
Application: IF
Species:

Bioinformatics

Gene Symbol TSPAN13
Entrez