![Immunocytochemistry/Immunofluorescence: TSPAN13 Antibody [NBP1-81001] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TSPAN13-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81001-img0012.jpg "Immunocytochemistry/Immunofluorescence: TSPAN13 Antibody [NBP1-81001] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit TSPAN13 Antibody - BSA Free (NBP1-81001) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TSPAN13 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. TSPAN13 antibody validated for ICC/IF from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||
|---|---|---|---|---|---|---|---|---|---|
-(01-ml)_NBP1-81001_7441.jpg)
Enlarge |
reviewed by:
Verified Customer |
IF | 05/09/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: TSPAN13 Antibody [NBP1-81001] - Staining of human small intestine shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/TSPAN13-Antibody-Immunohistochemistry-Paraffin-NBP1-81001-img0010.jpg "Immunohistochemistry-Paraffin: TSPAN13 Antibody [NBP1-81001] - Staining of human small intestine shows strong membranous positivity in glandular cells.")
![Immunocytochemistry/Immunofluorescence: TSPAN13 Antibody [NBP1-81001] - Staining of human pancreas cryosection (200x). Ducts are labeled. Image from verified customer review.](http://images.novusbio.com/fullsize/TSPAN13-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81001-img0005.jpg "Immunocytochemistry/Immunofluorescence: TSPAN13 Antibody [NBP1-81001] - Staining of human pancreas cryosection (200x). Ducts are labeled. Image from verified customer review.")
![Immunohistochemistry-Paraffin: TSPAN13 Antibody [NBP1-81001] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/TSPAN13-Antibody-Immunohistochemistry-Paraffin-NBP1-81001-img0008.jpg "Immunohistochemistry-Paraffin: TSPAN13 Antibody [NBP1-81001] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: TSPAN13 Antibody [NBP1-81001] - Staining of human skeletal muscle shows no membranous positivity in striated muscle fibers as expected.](http://images.novusbio.com/fullsize/TSPAN13-Antibody-Immunohistochemistry-Paraffin-NBP1-81001-img0009.jpg "Immunohistochemistry-Paraffin: TSPAN13 Antibody [NBP1-81001] - Staining of human skeletal muscle shows no membranous positivity in striated muscle fibers as expected.")
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot TROP-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/TROP-2_AF650_Western_Blot_12086.jpg)
![Immunohistochemistry TROP-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/TROP-2_AF650_Immunohistochemistry_7209.jpg)
![Flow Cytometry TROP-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/TROP-2_AF650_Flow_Cytometry_9384.jpg)
![SDS-PAGE TRANCE/TNFSF11/RANK L [Unconjugated]](https://images.novusbio.com/images2/TRANCE_462-TEC_442.jpg)
![Bioactivity TRANCE/TNFSF11/RANK L [Unconjugated]](https://images.novusbio.com/images2/TRANCE_462-TEC_556.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
-(01-ml)_NBP1-81001_7441.jpg)