TSPAN7/TM4SF2 Antibody (CL0262)

Images

 
Western Blot: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] - Lane 1: Marker [kDa], Lane 2: Negative control (vector only transfected HEK293T lysate), Lane 3: TSPAN7 Over-expression Lysate (Co-expressed with a C-terminal ...read more
Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] - Staining of human pancreas shows strong positivity in the islets of Langerhans.
Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] - Staining of human cerebellum shows strong positivity in the molecular layer and moderate staining in the granular cell layer.
Immunohistochemistry-Paraffin: TSPAN7/TM4SF2 Antibody (CL0262) [NBP2-52894] - Staining of human cerebral cortex shows strong immunoreactivity in the neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL0262
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TSPAN7/TM4SF2 Antibody (CL0262) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET
Epitope
NDERSRAVDHVQRSL
Specificity
Specificity of human TSPAN7/TM4SF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
TSPAN7
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TSPAN7/TM4SF2 Recombinant Protein Antigen (NBP2-52894PEP)
Publications
Read Publication using NBP2-52894.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for TSPAN7/TM4SF2 Antibody (CL0262)

  • A15
  • A15CCG-B7
  • CCG-B7
  • CD231 antigen
  • CD231
  • Cell surface glycoprotein A15
  • DXS1692E
  • Membrane component chromosome X surface marker 1
  • mental retardation, X-linked 58
  • MRX58
  • MXS1
  • MXS1T-cell acute lymphoblastic leukemia associated antigen 1
  • TALLA-1
  • T-cell acute lymphoblastic leukemia-associated antigen 1
  • tetraspanin 7
  • tetraspanin-7
  • TM4SF2
  • TM4SF2b
  • TM4SF2tetraspanin protein
  • transmembrane 4 superfamily 2b
  • Transmembrane 4 superfamily member 2X chromosome, surface marker 1
  • transmembrane protein A15
  • TSPAN7
  • tspan-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB500-327
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, In vitro, CyTOF-ready
NB100-65805
Species: Hu, Mu, Gt, Pm, Sh
Applications: WB, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP, In vitro, Flow-IC, IHC-WhMt
NBP2-21792
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-64810
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-33867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB500-393
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, IP, CyTOF-ready
NBP2-20237
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89124
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52493
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, CyTOF-ready
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
AF3117
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC

Publications for TSPAN7/TM4SF2 Antibody (NBP2-52894)(1)

Reviews for TSPAN7/TM4SF2 Antibody (NBP2-52894) (0)

There are no reviews for TSPAN7/TM4SF2 Antibody (NBP2-52894). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSPAN7/TM4SF2 Antibody (NBP2-52894) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TSPAN7/TM4SF2 Products

Bioinformatics Tool for TSPAN7/TM4SF2 Antibody (NBP2-52894)

Discover related pathways, diseases and genes to TSPAN7/TM4SF2 Antibody (NBP2-52894). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSPAN7/TM4SF2 Antibody (NBP2-52894)

Discover more about diseases related to TSPAN7/TM4SF2 Antibody (NBP2-52894).
 

Pathways for TSPAN7/TM4SF2 Antibody (NBP2-52894)

View related products by pathway.

Blogs on TSPAN7/TM4SF2

There are no specific blogs for TSPAN7/TM4SF2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSPAN7/TM4SF2 Antibody (CL0262) and receive a gift card or discount.

Bioinformatics

Gene Symbol TSPAN7