Tetraspanin-5 Antibody

Images

 
Western Blot: Tetraspanin-5 Antibody [NBP1-69337] - This Anti-TSPAN5 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.25ug/ml.
Immunohistochemistry: Tetraspanin-5 Antibody [NBP1-69337] - Human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tetraspanin-5 Antibody Summary

Immunogen
Synthetic peptides corresponding to TSPAN5(tetraspanin 5) The peptide sequence was selected from the middle region of TSPAN5. Peptide sequence ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSPAN5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Tetraspanin-5 Antibody

  • member 8
  • tetraspanin 5

Background

TSPAN5 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86784
Species: Hu
Applications: IHC, IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBL1-17368
Species: Hu
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
NB100-65805
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
MAB8405
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB4609
Species: Mu
Applications: Flow, CyTOF-ready, ICC
MAB4624
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
MAB6549
Species: Hu
Applications: WB
NBP2-33838
Species: Hu
Applications: IHC, IHC-P
NBP2-57551
Species: Hu
Applications: ICC/IF
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP1-87088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Tetraspanin-5 Antibody (NBP1-69337) (0)

There are no publications for Tetraspanin-5 Antibody (NBP1-69337).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tetraspanin-5 Antibody (NBP1-69337) (0)

There are no reviews for Tetraspanin-5 Antibody (NBP1-69337). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tetraspanin-5 Antibody (NBP1-69337) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tetraspanin-5 Products

Bioinformatics Tool for Tetraspanin-5 Antibody (NBP1-69337)

Discover related pathways, diseases and genes to Tetraspanin-5 Antibody (NBP1-69337). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tetraspanin-5 Antibody (NBP1-69337)

Discover more about diseases related to Tetraspanin-5 Antibody (NBP1-69337).
 

Pathways for Tetraspanin-5 Antibody (NBP1-69337)

View related products by pathway.

PTMs for Tetraspanin-5 Antibody (NBP1-69337)

Learn more about PTMs related to Tetraspanin-5 Antibody (NBP1-69337).

Blogs on Tetraspanin-5

There are no specific blogs for Tetraspanin-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tetraspanin-5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSPAN5
Uniprot