FBPase 1 Antibody

Images

 
Western Blot: FBPase 1 Antibody [NBP1-84721] - Analysis in human liver tissue.
Immunohistochemistry-Paraffin: FBPase 1 Antibody [NBP1-84721] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: FBPase 1 Antibody [NBP1-84721] - Staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: FBPase 1 Antibody [NBP1-84721] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: FBPase 1 Antibody [NBP1-84721] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Simple Western: FBPase 1 Antibody [NBP1-84721] - Simple Western lane view shows a specific band for FBP1 in 0.2 mg/ml of RT-4 (left) and NIH-3T3 (right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: FBPase 1 Antibody [NBP1-84721] - Electropherogram image(s) of corresponding Simple Western lane view. FBPase 1 antibody was used at 1:20 dilution on RT-4 and NIH-3T3 lysates(s).

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBPase 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
FBPase 1 Protein (NBP1-84721PEP)
Publications
Read Publication using NBP1-84721.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25043030). Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FBPase 1 Antibody

  • D-fructose-1,6-bisphosphate 1-phosphohydrolase 1
  • EC 3.1.3
  • EC 3.1.3.11
  • FBP
  • FBP1
  • FBPase 1
  • fructose-1,6-bisphosphatase 1
  • fructose-bisphosphatase 1
  • growth-inhibiting protein 17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5646
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-16543
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
AF842
Species: Hu
Applications: WB
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-90367
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-57033
Species: Hu
Applications: WB
NBP1-54825
Species: Hu
Applications: WB, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
AF6517
Species: Hu
Applications: WB
NB100-40840
Species: Hu, Mu
Applications: WB, IHC-P, IP

Publications for FBPase 1 Antibody (NBP1-84721)(1)


Reviews for FBPase 1 Antibody (NBP1-84721) (0)

There are no reviews for FBPase 1 Antibody (NBP1-84721). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBPase 1 Antibody (NBP1-84721) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBPase 1 Products

Bioinformatics Tool for FBPase 1 Antibody (NBP1-84721)

Discover related pathways, diseases and genes to FBPase 1 Antibody (NBP1-84721). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBPase 1 Antibody (NBP1-84721)

Discover more about diseases related to FBPase 1 Antibody (NBP1-84721).
 

Pathways for FBPase 1 Antibody (NBP1-84721)

View related products by pathway.

PTMs for FBPase 1 Antibody (NBP1-84721)

Learn more about PTMs related to FBPase 1 Antibody (NBP1-84721).
 

Research Areas for FBPase 1 Antibody (NBP1-84721)

Find related products by research area.

Blogs on FBPase 1

There are no specific blogs for FBPase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBPase 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBP1
Entrez