FBPase 1 Antibody

Immunohistochemistry-Paraffin: FBPase 1 Antibody [NBP1-84721] - Staining in human liver and skeletal muscle tissues . Corresponding FBP1 RNA-seq data are presented for the same tissues.

Western Blot: FBPase 1 Antibody [NBP1-84721] - Analysis in human liver tissue.

Immunohistochemistry-Paraffin: FBPase 1 Antibody [NBP1-84721] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: FBPase 1 Antibody [NBP1-84721] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: FBPase 1 Antibody [NBP1-84721] - Staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: FBPase 1 Antibody [NBP1-84721] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Simple Western: FBPase 1 Antibody [NBP1-84721] - Simple Western lane view shows a specific band for FBP1 in 0.2 mg/ml of RT-4 (left) and NIH-3T3 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: FBPase 1 Antibody [NBP1-84721] - Electropherogram image(s) of corresponding Simple Western lane view. FBPase 1 antibody was used at 1:20 dilution on RT-4 and NIH-3T3 lysates(s).

• Reactivity: Hu, Mu
• Applications: WB, Simple Western, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

FBPase 1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAP
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  FBPase 1 Protein (NBP1-84721PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25043030). Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FBPase 1 Antibody

• D-fructose-1,6-bisphosphate 1-phosphohydrolase 1
• EC 3.1.3
• EC 3.1.3.11
• FBP
• FBP1
• FBPase 1
• fructose-1,6-bisphosphatase 1
• fructose-bisphosphatase 1
• growth-inhibiting protein 17

Background

Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FBPase 1 Antibody (NBP1-84721)(1)

Publication using NBP1-84721

• Li B, Qiu B, Lee DS et al. Fructose-1, 6-bisphosphatase opposes renal carcinoma progression. Nature 2014-09-11 [PMID: 25043030]

Bioinformatics

• Gene Symbol: FBP1