TRPM4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TRPM4 Antibody [NBP2-13487] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TRPM4 Antibody [NBP2-13487] - Staining in human prostate and lymph node tissues using anti-TRPM4 antibody. Corresponding TRPM4 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: TRPM4 Antibody [NBP2-13487] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: TRPM4 Antibody [NBP2-13487] - Staining of human prostate shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TRPM4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GTGIDIPVLLLLIDGDEKMLTRIENATQAQLPCLLVAGSGGAADCLAETL EDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQVERIMTRKE
Specificity
Specificity of human TRPM4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRPM4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRPM4 Protein (NBP2-13487PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRPM4 Antibody

  • Calcium-activated non-selective cation channel 1
  • FLJ20041
  • hTRPM4
  • Long transient receptor potential channel 4
  • LTRPC4
  • LTrpC-4
  • melastatin-4
  • PFHB1B
  • transient receptor potential cation channel subfamily M member 4
  • transient receptor potential cation channel, subfamily M, member 4
  • TRPM4B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-98867
Species: Rt
Applications: WB, IHC
NBP2-58525
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
NBP1-70352
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IF
NB200-145
Species: Hu, Mu, Dr
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-74960
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-32096
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NB110-74925
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-98864
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00140803-R03
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-40763
Species: Hu, Mu, Rt, GP
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-20989
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-13487
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TRPM4 Antibody (NBP2-13487) (0)

There are no publications for TRPM4 Antibody (NBP2-13487).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPM4 Antibody (NBP2-13487) (0)

There are no reviews for TRPM4 Antibody (NBP2-13487). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRPM4 Antibody (NBP2-13487) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRPM4 Products

Bioinformatics Tool for TRPM4 Antibody (NBP2-13487)

Discover related pathways, diseases and genes to TRPM4 Antibody (NBP2-13487). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRPM4 Antibody (NBP2-13487)

Discover more about diseases related to TRPM4 Antibody (NBP2-13487).
 

Pathways for TRPM4 Antibody (NBP2-13487)

View related products by pathway.

PTMs for TRPM4 Antibody (NBP2-13487)

Learn more about PTMs related to TRPM4 Antibody (NBP2-13487).

Blogs on TRPM4.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRPM4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPM4