tropomyosin-3 Antibody

Images

 
Western Blot: tropomyosin-3 Antibody [NBP1-87382] - Analysis in human cell line THP-1.
Immunohistochemistry-Paraffin: tropomyosin-3 Antibody [NBP1-87382] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Western Blot: tropomyosin-3 Antibody [NBP1-87382] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

tropomyosin-3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPM3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
tropomyosin-3 Protein (NBP1-87382PEP)
Publications
Read Publication using NBP1-87382.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25486436)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for tropomyosin-3 Antibody

  • cytoskeletal tropomyosin TM30
  • FLJ41118
  • gamma-tropomyosin
  • heat-stable cytoskeletal protein 30 kDa
  • hscp30
  • hTM5
  • MGC14582
  • MGC3261
  • MGC72094
  • NEM1
  • OK/SW-cl.5
  • TM3
  • TM30
  • TM30nm
  • TM-5
  • TPMsk3
  • TRK
  • tropomyosin 3
  • tropomyosin alpha-3 chain
  • tropomyosin gamma
  • tropomyosin-3
  • tropomyosin-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF1404
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NBP1-47897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-40561
Species: Hu
Applications: WB, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF-303-NA
Species: Hu
Applications: WB, Neut
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for tropomyosin-3 Antibody (NBP1-87382)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for tropomyosin-3 Antibody (NBP1-87382) (0)

There are no reviews for tropomyosin-3 Antibody (NBP1-87382). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for tropomyosin-3 Antibody (NBP1-87382) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional tropomyosin-3 Products

Bioinformatics Tool for tropomyosin-3 Antibody (NBP1-87382)

Discover related pathways, diseases and genes to tropomyosin-3 Antibody (NBP1-87382). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for tropomyosin-3 Antibody (NBP1-87382)

Discover more about diseases related to tropomyosin-3 Antibody (NBP1-87382).
 

Pathways for tropomyosin-3 Antibody (NBP1-87382)

View related products by pathway.

PTMs for tropomyosin-3 Antibody (NBP1-87382)

Learn more about PTMs related to tropomyosin-3 Antibody (NBP1-87382).

Blogs on tropomyosin-3

There are no specific blogs for tropomyosin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our tropomyosin-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPM3