TRIP1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit TRIP1 Antibody - BSA Free (NBP1-84873) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
EIF3I |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 0.04-0.4 ug/ml
|
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TRIP1 Antibody - BSA Free
Background
TRIP1 is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, e
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ChIP, IP, KD, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: BA
Species: Hu, Xp
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Bv, Ca, Eq, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Publications for TRIP1 Antibody (NBP1-84873) (0)
There are no publications for TRIP1 Antibody (NBP1-84873).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRIP1 Antibody (NBP1-84873) (0)
There are no reviews for TRIP1 Antibody (NBP1-84873).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TRIP1 Antibody (NBP1-84873) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TRIP1 Products
Research Areas for TRIP1 Antibody (NBP1-84873)
Find related products by research area.
|
Blogs on TRIP1