Triosephosphate isomerase Antibody

Images

 
Independent Antibodies: Western Blot: Triosephosphate isomerase Antibody [NBP2-56753] - Analysis using Anti-TPI1 antibody NBP2-56753 (A) shows similar pattern to independent antibody NBP2-58150 (B).
Immunocytochemistry/ Immunofluorescence: Triosephosphate isomerase Antibody [NBP2-56753] - Staining of human cell line MCF7 shows localization to nucleus & vesicles.
Immunohistochemistry: Triosephosphate isomerase Antibody [NBP2-56753] - Immunohistochemical staining of human parathyroid gland shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

Triosephosphate isomerase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GEEAEFHFAALYISGQWPRLRADTDLQRLGSSAMAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDP
Specificity
Specificity of human Triosephosphate isomerase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPI1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Triosephosphate isomerase Antibody

  • EC 5.3.1.1
  • MGC88108
  • TIM
  • TPI
  • triosephosphate isomerase 1
  • triosephosphate isomerase
  • Triose-phosphate isomerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Eq, Fe, Ha, Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single Cell Western
NB100-40853
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-67503
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-24589
Species: Hu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00002023-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-76701
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF2365
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-84916
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-77397
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
MAB9080
Species: Hu
Applications: WB
AF2929
Species: Hu
Applications: WB, IHC

Publications for Triosephosphate isomerase Antibody (NBP2-56753) (0)

There are no publications for Triosephosphate isomerase Antibody (NBP2-56753).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Triosephosphate isomerase Antibody (NBP2-56753) (0)

There are no reviews for Triosephosphate isomerase Antibody (NBP2-56753). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Triosephosphate isomerase Antibody (NBP2-56753) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Triosephosphate isomerase Products

Bioinformatics Tool for Triosephosphate isomerase Antibody (NBP2-56753)

Discover related pathways, diseases and genes to Triosephosphate isomerase Antibody (NBP2-56753). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Triosephosphate isomerase Antibody (NBP2-56753)

Discover more about diseases related to Triosephosphate isomerase Antibody (NBP2-56753).
 

Pathways for Triosephosphate isomerase Antibody (NBP2-56753)

View related products by pathway.

PTMs for Triosephosphate isomerase Antibody (NBP2-56753)

Learn more about PTMs related to Triosephosphate isomerase Antibody (NBP2-56753).
 

Research Areas for Triosephosphate isomerase Antibody (NBP2-56753)

Find related products by research area.

Blogs on Triosephosphate isomerase.

GLO1 Antibodies for Diabetes and Cancer Studies
We at Novus Biologicals are one of the leading antibody suppliers for diabetes research. An aging population, and the increasing incidence of type 2 diabetes, makes it an area of increasing interest - especially as there is often a close link to cance...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Triosephosphate isomerase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPI1