TRIAD3 Antibody


Immunocytochemistry/ Immunofluorescence: TRIAD3 Antibody [NBP1-86907] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907] - Staining of human small intestine shows moderate positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

TRIAD3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VKETEARFPDVANGFIEEIIHFKNYYDLNVLCNFLLENPDYPKREDRIIINPSSSLLASQDETKLPKIDFFDYSKLTPLD
Specificity of human TRIAD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRIAD3 Protein (NBP1-86907PEP)
Read Publication using NBP1-86907.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TRIAD3 Antibody

  • EC 6.3.2.-
  • ring finger protein 216Ubiquitin-conjugating enzyme 7-interacting protein 1
  • Triad domain-containing protein 3
  • TRIAD3Zinc finger protein inhibiting NF-kappa-B
  • U7I1
  • UBCE7IP1ubiquitin conjugating enzyme 7 interacting protein 1
  • ZINE3 ubiquitin-protein ligase RNF216


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Pm, Rb
Applications: WB, Flow
Species: Hu
Applications: Flow, AgAct, CyTOF-reported
Species: Hu, Ca
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP, Flow-CS
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TRIAD3 Antibody (NBP1-86907)(1)

Reviews for TRIAD3 Antibody (NBP1-86907) (0)

There are no reviews for TRIAD3 Antibody (NBP1-86907). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRIAD3 Antibody (NBP1-86907) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TRIAD3 Products

Bioinformatics Tool for TRIAD3 Antibody (NBP1-86907)

Discover related pathways, diseases and genes to TRIAD3 Antibody (NBP1-86907). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIAD3 Antibody (NBP1-86907)

Discover more about diseases related to TRIAD3 Antibody (NBP1-86907).

Pathways for TRIAD3 Antibody (NBP1-86907)

View related products by pathway.

PTMs for TRIAD3 Antibody (NBP1-86907)

Learn more about PTMs related to TRIAD3 Antibody (NBP1-86907).

Blogs on TRIAD3

There are no specific blogs for TRIAD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRIAD3 Antibody and receive a gift card or discount.


Gene Symbol RNF216