TRIAD3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TRIAD3 Antibody [NBP1-86907] - Staining of human cell line U-2 OS shows positivity in cytoplasm.

Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907] - Staining of human Prostate shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907] - Staining of human Cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907] - Staining of human Pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86907] - Staining of human Testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts and leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRIAD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRIAD3 Antibody - BSA Free (NBP1-86907) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-TRIAD3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VKETEARFPDVANGFIEEIIHFKNYYDLNVLCNFLLENPDYPKREDRIIINPSSSLLASQDETKLPKIDFFDYSKLTPLD
• Predicted Species: Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF216
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TRIAD3 Protein (NBP1-86907PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TRIAD3 Antibody - BSA Free

• EC 6.3.2.-
• ring finger protein 216Ubiquitin-conjugating enzyme 7-interacting protein 1
• Triad domain-containing protein 3
• TRIAD3Zinc finger protein inhibiting NF-kappa-B
• U7I1
• UBCE7IP1ubiquitin conjugating enzyme 7 interacting protein 1
• ZINE3 ubiquitin-protein ligase RNF216

Background

The TRIAD3 gene encodes a cytoplasmic protein which specifically colocalizes and interacts with the serine/threonine protein kinase, receptor-interacting protein (RIP). Zinc finger domains of the encoded protein are required for its interaction with RIP and for inhibition of TNF- and IL1-induced NF-kappa B activation pathways. The encoded protein may also function as an E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes and transfers it to substrates. Several alternatively spliced transcript variants have been described for this locus but the full-length natures of only some are known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRIAD3 Antibody (NBP1-86907)(1)

Publication using NBP1-86907

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: RNF216