APOBEC3G Antibody

Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human spleen shows moderate to strong cytoplasmic positivity in cells in red pulp.

Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human pancreas shows no positivity as expected.

Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human stomach shows moderate to strong cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Analysis in human lymph node and pancreas tissues. Corresponding APOBEC3G RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

APOBEC3G Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APOBEC3G
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  APOBEC3G Protein (NBP1-88592PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24025770)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for APOBEC3G Antibody

• APOBEC-related cytidine deaminase
• APOBEC-related protein 9
• APOBEC-related protein
• apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
• ARCD
• ARP-9
• bK150C2.7
• CEM-15
• CEM15ARP9
• dJ494G10.1
• DNA dC->dU-editing enzyme APOBEC-3G
• EC 3.5.4
• EC 3.5.4.-
• EC 3.5.4.5
• FLJ12740DNA dC->dU editing enzyme
• MDS019
• phorbolin-like protein MDS019

Background

APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for APOBEC3G Antibody (NBP1-88592)(2)

Publications using NBP1-88592

• Sandler NG, Bosinger SE, Estes JD et al. Type I interferon responses in rhesus macaques prevent SIV infection and slow disease progression. Nature 2014-07-31 [PMID: 25043006]
• Hansen SG, Piatak M Jr, Ventura AB et al. Immune clearance of highly pathogenic SIV infection. Nature 2013-10-03 [PMID: 24025770]

Bioinformatics

• Gene Symbol: APOBEC3G