APOBEC3G Antibody

Images

 
Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human spleen shows moderate to strong cytoplasmic positivity in cells in red pulp.
Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human pancreas shows no positivity as expected.
Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human stomach shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Analysis in human lymph node and pancreas tissues. Corresponding APOBEC3G RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

APOBEC3G Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOBEC3G
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
APOBEC3G Protein (NBP1-88592PEP)
Publications
Read Publications using NBP1-88592.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24025770)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APOBEC3G Antibody

  • APOBEC-related cytidine deaminase
  • APOBEC-related protein 9
  • APOBEC-related protein
  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
  • ARCD
  • ARP-9
  • bK150C2.7
  • CEM-15
  • CEM15ARP9
  • dJ494G10.1
  • DNA dC->dU-editing enzyme APOBEC-3G
  • EC 3.5.4
  • EC 3.5.4.-
  • EC 3.5.4.5
  • FLJ12740DNA dC->dU editing enzyme
  • MDS019
  • phorbolin-like protein MDS019

Background

APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. The protein encoded by this gene has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for APOBEC3G Antibody (NBP1-88592)(2)

Reviews for APOBEC3G Antibody (NBP1-88592) (0)

There are no reviews for APOBEC3G Antibody (NBP1-88592). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for APOBEC3G Antibody (NBP1-88592) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APOBEC3G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOBEC3G