APOBEC3G Antibody

Images

 
Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APOBEC3G Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOBEC3G
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
APOBEC3G Protein (NBP1-88592PEP)
Publications
Read Publications using NBP1-88592.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24025770)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APOBEC3G Antibody

  • APOBEC-related cytidine deaminase
  • APOBEC-related protein 9
  • APOBEC-related protein
  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
  • ARCD
  • ARP-9
  • bK150C2.7
  • CEM-15
  • CEM15ARP9
  • dJ494G10.1
  • DNA dC->dU-editing enzyme APOBEC-3G
  • EC 3.5.4
  • EC 3.5.4.-
  • EC 3.5.4.5
  • FLJ12740DNA dC->dU editing enzyme
  • MDS019
  • phorbolin-like protein MDS019

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57516
Species: Hu
Applications: WB
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57372
Species: Hu
Applications: WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57602
Species: Hu
Applications: ICC/IF
NBP1-76601
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-22970
Species: Hu, Mu
Applications: WB, IHC-P, IP
DDX0390P-100
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-88999
Species: Hu
Applications: IHC, IHC-P
NBP1-06977
Species: Mu
Applications: WB, PEP-ELISA
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for APOBEC3G Antibody (NBP1-88592)(2)

Reviews for APOBEC3G Antibody (NBP1-88592) (0)

There are no reviews for APOBEC3G Antibody (NBP1-88592). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for APOBEC3G Antibody (NBP1-88592) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APOBEC3G Products

Bioinformatics Tool for APOBEC3G Antibody (NBP1-88592)

Discover related pathways, diseases and genes to APOBEC3G Antibody (NBP1-88592). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOBEC3G Antibody (NBP1-88592)

Discover more about diseases related to APOBEC3G Antibody (NBP1-88592).
 

Pathways for APOBEC3G Antibody (NBP1-88592)

View related products by pathway.

PTMs for APOBEC3G Antibody (NBP1-88592)

Learn more about PTMs related to APOBEC3G Antibody (NBP1-88592).

Blogs on APOBEC3G

There are no specific blogs for APOBEC3G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APOBEC3G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOBEC3G