TRIAD3 Antibody

Images

 
Immunohistochemistry-Paraffin: TRIAD3 Antibody [NBP1-86906] - Staining of human testis shows strong cytoplasmic positivity in developing sperm cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIAD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KVIILEEGSLLYTESDPLETQNQSSEDSETELLSNLGESAALADDQAIEEDCWLDHPYFQSLNQQPREITNQVVPQERQPEAELGRLLFQHEFPGPAFP
Localization
Nucleus
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF216
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100.
Theoretical MW
99 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
TRIAD3 Protein (NBP1-86906PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIAD3 Antibody

  • EC 6.3.2.-
  • ring finger protein 216Ubiquitin-conjugating enzyme 7-interacting protein 1
  • Triad domain-containing protein 3
  • TRIAD3Zinc finger protein inhibiting NF-kappa-B
  • U7I1
  • UBCE7IP1ubiquitin conjugating enzyme 7 interacting protein 1
  • ZINE3 ubiquitin-protein ligase RNF216

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-53089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Other, Pm, Rb
Applications: WB, Flow
MAB2238
Species: Hu
Applications: Flow, AgAct, CyTOF-reported
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-81706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TRIAD3 Antibody (NBP1-86906) (0)

There are no publications for TRIAD3 Antibody (NBP1-86906).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIAD3 Antibody (NBP1-86906) (0)

There are no reviews for TRIAD3 Antibody (NBP1-86906). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRIAD3 Antibody (NBP1-86906) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIAD3 Products

Bioinformatics Tool for TRIAD3 Antibody (NBP1-86906)

Discover related pathways, diseases and genes to TRIAD3 Antibody (NBP1-86906). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIAD3 Antibody (NBP1-86906)

Discover more about diseases related to TRIAD3 Antibody (NBP1-86906).
 

Pathways for TRIAD3 Antibody (NBP1-86906)

View related products by pathway.

PTMs for TRIAD3 Antibody (NBP1-86906)

Learn more about PTMs related to TRIAD3 Antibody (NBP1-86906).

Blogs on TRIAD3

There are no specific blogs for TRIAD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIAD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF216
Entrez
Uniprot