TOX Antibody - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: TOX Antibody [NBP3-04932] - Analysis of U2OS cells using TOx antibody .

Immunohistochemistry: TOX Antibody - Azide and BSA Free [TOX] - Immunohistochemistry analysis of paraffin-embedded Human spleen using TOX Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: TOX Antibody - Azide and BSA Free [TOX] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using TOX Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: TOX Antibody - Azide and BSA Free [TOX] - Immunohistochemistry analysis of paraffin-embedded Human kidney using TOX Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: TOX Antibody - Azide and BSA Free [TOX] - Immunohistochemistry analysis of paraffin-embedded Rat liver using TOX Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: TOX Antibody - Azide and BSA Free [TOX] - Western blot analysis of lysates from Mouse brain, using TOX Rabbit pAb at 1:400 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 180s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TOX Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-165 of human TOX (NP_055544.1). YYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQNMDLPEITVSNMLGQDGTLLSNSISVMPDIRNPEGTQYSSHPQMAAMRPRGQPA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOX
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500-1:2000
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for TOX Antibody - Azide and BSA Free

• KIAA0808
• KIAA0808TOX1
• thymocyte selection-associated high mobility group box protein TOX
• thymocyte selection-associated high mobility group box
• Thymus high mobility group box protein TOX
• TOX
• TOX1

Background

The protein encoded by the thymocyte selection-associated high mobility group box gene contains a HMG box DNA binding domain. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. This protein may function to regulate T-cell development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOX