TMTC1 Antibody

Images

 
Western Blot: TMTC1 Antibody [NBP1-88837] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: TMTC1 Antibody [NBP1-88837] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: TMTC1 Antibody [NBP1-88837] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMTC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GITVFGVCLVYDLFSLSNKQDKSSNGALCPRSPQQPGSPQPSSLPGHPHRENGKQQRFPHKGAWGGCHSPLPPEPKSSGFPVSPRAVWSMMR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMTC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMTC1 Protein (NBP1-88837PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMTC1 Antibody

  • ARG99
  • FLJ31400
  • FLJ41625
  • OLF
  • TMTC1A
  • transmembrane and tetratricopeptide repeat containing 1
  • transmembrane and tetratricopeptide repeat containing 1A
  • transmembrane and TPR repeat-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5165
Species: Hu, Mu
Applications: WB
NBP2-57466
Species: Hu
Applications: ICC/IF
AF7006
Species: Hu, Mu
Applications: WB, IHC
NB120-6588
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NBP2-15055
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76580
Species: Hu
Applications: WB, ELISA, ICC/IF, ICC
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49461
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, In vivo
NBP1-88837
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TMTC1 Antibody (NBP1-88837) (0)

There are no publications for TMTC1 Antibody (NBP1-88837).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMTC1 Antibody (NBP1-88837) (0)

There are no reviews for TMTC1 Antibody (NBP1-88837). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TMTC1 Antibody (NBP1-88837) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMTC1 Products

Bioinformatics Tool for TMTC1 Antibody (NBP1-88837)

Discover related pathways, diseases and genes to TMTC1 Antibody (NBP1-88837). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMTC1 Antibody (NBP1-88837)

Discover more about diseases related to TMTC1 Antibody (NBP1-88837).

Blogs on TMTC1

There are no specific blogs for TMTC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMTC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMTC1