KAL1 Antibody

Western Blot: KAL1 Antibody [NBP3-03937] - Analysis of extracts of various cell lines, using KAL1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 5s.

Immunohistochemistry: KAL1 Antibody [NBP3-03937] - Analysis of mouse brain using KAL1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry: KAL1 Antibody [NBP3-03937] - Analysis of rat brain using KAL1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry: KAL1 Antibody [NBP3-03937] - Analysis of rat brain using KAL1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry: KAL1 Antibody [NBP3-03937] - Analysis of mouse brain using KAL1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

KAL1 Antibody Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human KAL1 (NP_000207.2). LEVKWSSKFNISIEPVIYVVQRRWNYGIHPSEDDATHWQTVAQTTDERVQLTDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSAPPAPANLRLAN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANOS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 76 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS with 50% glycerol, pH7.3.
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for KAL1 Antibody

• Adhesion molecule-like X-linked
• ADMLX
• ADMLXHHA
• ANOS1
• Anosmin 1
• anosmin-1
• HH1
• HHA
• KAL
• KAL1
• KALIG1
• KALIG-1
• Kallmann syndrome 1 sequence
• Kallmann syndrome interval gene 1
• Kallmann syndrome protein
• Kallmann syndrome-1 sequence (anosmin-1)
• KMS

Background

KAL1 is a gene which codes for a protein that is expressed in the cerebellum and plays an important role in the patterning of cell collaterals to the olfactory cortex while also working as a chemo-attractant for fetal olfactory cells, with a length of 680 amino acids, and a weight of approximately 76 kDa. Studies are being conducted on diseases and disorders related to this gene including Kallmann syndrome, x-linked ichtyhosis, typhus, vesicoureteral reflux, delayed puberty, tooth agenesis, gonadotropin deficiency, charge syndrome, and atopic dermatitis. KAL1 has also been shown to have interactions with SDC2, FGFR1, FGF2, and FGFR2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANOS1