TM7SF2 Antibody - Azide and BSA Free

Western Blot: TM7SF2 Antibody [NBP2-93095] - Analysis of extracts of Mouse uterus, using TM7SF2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TM7SF2 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-250 of human TM7SF2 (NP_003264.2). LAPGGNSGNPIYDFFLGRELNPRICFFDFKYFCELRPGLIGWVLINLALLMKEAELRGSPSLAMWLVNGFQLLYVGDALWHEEAVLTTMDI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TM7SF2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TM7SF2 Antibody - Azide and BSA Free

• ANG1
• C-14 sterol reductase
• delta(14)-sterol reductase
• delta-14-SR
• DHCR14A
• NET47
• putative sterol reductase SR-1
• sterol C14-reductase
• transmembrane 7 superfamily member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TM7SF2