TM7SF2 Antibody

Images

 
Immunohistochemistry: TM7SF2 Antibody [NBP1-89089] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TM7SF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QVAPVSALAPGGNSGNPIYDFFLGRELNPRICFFDFKYFCELRPGLIGWVLINLALLMKEAELRGSPSLAMWLVNGFQLLYVGDALWHEEAVLTTM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TM7SF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TM7SF2 Protein (NBP1-89089PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TM7SF2 Antibody

  • ANG1
  • C-14 sterol reductase
  • delta(14)-sterol reductase
  • delta-14-SR
  • DHCR14A
  • NET47
  • putative sterol reductase SR-1
  • sterol C14-reductase
  • transmembrane 7 superfamily member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF313
Species: Hu
Applications: WB, Simple Western, IHC, Block
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
AF619
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NB100-215
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89089
Species: Hu
Applications: IHC, IHC-P

Publications for TM7SF2 Antibody (NBP1-89089) (0)

There are no publications for TM7SF2 Antibody (NBP1-89089).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TM7SF2 Antibody (NBP1-89089) (0)

There are no reviews for TM7SF2 Antibody (NBP1-89089). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TM7SF2 Antibody (NBP1-89089) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TM7SF2 Products

Bioinformatics Tool for TM7SF2 Antibody (NBP1-89089)

Discover related pathways, diseases and genes to TM7SF2 Antibody (NBP1-89089). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TM7SF2 Antibody (NBP1-89089)

Discover more about diseases related to TM7SF2 Antibody (NBP1-89089).
 

Pathways for TM7SF2 Antibody (NBP1-89089)

View related products by pathway.

Blogs on TM7SF2

There are no specific blogs for TM7SF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TM7SF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TM7SF2