integrin beta 4 binding protein Antibody

Images

 
Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: integrin beta 4 binding protein Antibody [NBP2-13954] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.
Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

integrin beta 4 binding protein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGS YCVFSNQGGLVHPKTSIEDQDELSSLLQVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
integrin beta 4 binding protein Protein (NBP2-13954PEP)
Publications
Read Publication using
NBP2-13954 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27119753).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for integrin beta 4 binding protein Antibody

  • B(2)GCN homolog
  • b(2)gcn
  • B4 integrin interactor
  • CAB
  • EIF3Ap27(BBP)
  • eIF-6
  • eukaryotic translation initiation factor 3A
  • eukaryotic translation initiation factor 6
  • ITGB4BPintegrin beta 4 binding protein
  • p27 beta-4 integrin-binding protein
  • p27BBP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13436
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2859
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-86589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for integrin beta 4 binding protein Antibody (NBP2-13954)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for integrin beta 4 binding protein Antibody (NBP2-13954) (0)

There are no reviews for integrin beta 4 binding protein Antibody (NBP2-13954). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for integrin beta 4 binding protein Antibody (NBP2-13954) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional integrin beta 4 binding protein Products

Bioinformatics Tool for integrin beta 4 binding protein Antibody (NBP2-13954)

Discover related pathways, diseases and genes to integrin beta 4 binding protein Antibody (NBP2-13954). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for integrin beta 4 binding protein Antibody (NBP2-13954)

Discover more about diseases related to integrin beta 4 binding protein Antibody (NBP2-13954).
 

Pathways for integrin beta 4 binding protein Antibody (NBP2-13954)

View related products by pathway.

PTMs for integrin beta 4 binding protein Antibody (NBP2-13954)

Learn more about PTMs related to integrin beta 4 binding protein Antibody (NBP2-13954).
 

Research Areas for integrin beta 4 binding protein Antibody (NBP2-13954)

Find related products by research area.

Blogs on integrin beta 4 binding protein

There are no specific blogs for integrin beta 4 binding protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our integrin beta 4 binding protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF6