integrin beta 4 binding protein Antibody

Images

 
Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: integrin beta 4 binding protein Antibody [NBP2-13954] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.
Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Colon shows strong nuclear and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Skin shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Analysis in human skin and skeletal muscle tissues using NBP2-13954 antibody. Corresponding EIF6 ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

integrin beta 4 binding protein Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
integrin beta 4 binding protein Protein (NBP2-13954PEP)
Publications
Read Publication using
NBP2-13954 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27119753).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for integrin beta 4 binding protein Antibody

  • B(2)GCN homolog
  • b(2)gcn
  • B4 integrin interactor
  • CAB
  • EIF3Ap27(BBP)
  • eIF-6
  • eukaryotic translation initiation factor 3A
  • eukaryotic translation initiation factor 6
  • ITGB4BPintegrin beta 4 binding protein
  • p27 beta-4 integrin-binding protein
  • p27BBP

Background

Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for integrin beta 4 binding protein Antibody (NBP2-13954)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for integrin beta 4 binding protein Antibody (NBP2-13954) (0)

There are no reviews for integrin beta 4 binding protein Antibody (NBP2-13954). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for integrin beta 4 binding protein Antibody (NBP2-13954) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional integrin beta 4 binding protein Products

Research Areas for integrin beta 4 binding protein Antibody (NBP2-13954)

Find related products by research area.

Blogs on integrin beta 4 binding protein

There are no specific blogs for integrin beta 4 binding protein, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our integrin beta 4 binding protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF6