NHE6/SLC9A6 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: NHE6/SLC9A6 Antibody [NBP2-38877] - Analysis in human cerebral cortex and liver tissues using NBP2-38877 antibody. Corresponding NHE6/SLC9A6 RNA-seq data are ...read more
Immunocytochemistry/ Immunofluorescence: NHE6/SLC9A6 Antibody [NBP2-38877] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NHE6/SLC9A6 Antibody [NBP2-38877] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: NHE6/SLC9A6 Antibody [NBP2-38877] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: NHE6/SLC9A6 Antibody [NBP2-38877] - Staining of human heart muscle shows moderate positivity in the intercalated discs in cardiomyocytes.
Immunohistochemistry-Paraffin: NHE6/SLC9A6 Antibody [NBP2-38877] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

NHE6/SLC9A6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GGTTAMLSCLHIRVGVDSDQEHLGVPENERRTTKAESAW
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC9A6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NHE6/SLC9A6 Protein (NBP2-38877PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NHE6/SLC9A6 Antibody

  • MRSA
  • NHE6
  • NHE6isoform 6
  • SLC9A6
  • solute carrier family 9 (sodium/hydrogen exchanger), member 6
  • Solute carrier family 9 member 6

Background

SLC9A6 - solute carrier family 9 (sodium/hydrogen exchanger), isoform 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NHE6/SLC9A6 Antibody (NBP2-38877) (0)

There are no publications for NHE6/SLC9A6 Antibody (NBP2-38877).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHE6/SLC9A6 Antibody (NBP2-38877) (0)

There are no reviews for NHE6/SLC9A6 Antibody (NBP2-38877). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NHE6/SLC9A6 Antibody (NBP2-38877) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NHE6/SLC9A6 Products

Research Areas for NHE6/SLC9A6 Antibody (NBP2-38877)

Find related products by research area.

Blogs on NHE6/SLC9A6

There are no specific blogs for NHE6/SLC9A6, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NHE6/SLC9A6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC9A6
Uniprot