TKTL1 Antibody - BSA Free

Analysis in human testis and endometrium tissues Corresponding TKTL1 RNA-seq data are presented for the same tissues.

Staining of human prostate shows very weak positivity in glandular cells.

Staining of human endometrium shows very weak positivity in glandular cells.

Staining of human testis shows strong cytoplasmic positivity in spermatogonia.

Staining of human kidney shows no positivity in cells in tubules as expected.

Analysis in human testis tissue.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TKTL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TKTL1 Antibody - BSA Free (NBP1-86939) is a polyclonal antibody validated for use in IHC and WB. Anti-TKTL1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SFSHPTSCSSSSEIMSVLFFYIMRYKQSDPENPDNDRFVLAKRLSFVDVATGWLGQGLGVACGMAYTGKYFDRASYRVFCLMSDGESS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TKTL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC-P reported in scientific literature (PMID: 25945836). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TKTL1 Recombinant Protein Antigen (NBP1-86939PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26187043).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TKTL1 Antibody - BSA Free

• TK 2
• TKR EC 2.2.1.1
• TKR
• TKT2Transketolase 2
• transketolase-2
• transketolase-like 1
• transketolase-like protein 1
• Transketolase-related protein

Background

Transketolase is a thiamine-dependent enzyme that links the pentose phosphate pathway with the glycolytic pathway. TKTL1 is a transketolase-related protein. TKTL1 is upregulated in many cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TKTL1 Antibody (NBP1-86939)(2)

Publications using NBP1-86939

• Kammerer U, Gires O, Pfetzer N et al. TKTL1 expression in human malign and benign cell lines. BMC Cancer 2015-06-10 [PMID: 26187043] (WB, IF/IHC, Human)
• Lucarelli G, Galleggiante V, Rutigliano M et al. Metabolomic profile of glycolysis and the pentose phosphate pathway identifies the central role of glucose-6-phosphate dehydrogenase in clear cell-renal cell carcinoma. Oncotarget. [PMID: 25945836] (IHC-P, Human)
  
  Details:
  Citation using the FITC form of this antibody.

Bioinformatics

• Gene Symbol: TKTL1