TKTL1 Antibody

Images

 
Western Blot: TKTL1 Antibody [NBP1-86939] - Analysis in human testis tissue.
Immunohistochemistry-Paraffin: TKTL1 Antibody [NBP1-86939] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: TKTL1 Antibody [NBP1-86939] - Staining of human testis shows strong cytoplasmic positivity with a granular pattern in seminiferous duct cells.
Immunohistochemistry-Paraffin: TKTL1 Antibody [NBP1-86939] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: TKTL1 Antibody [NBP1-86939] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: TKTL1 Antibody [NBP1-86939] - Staining in human testis and endometrium tissues using anti-TKTL1 antibody. Corresponding TKTL1 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TKTL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SFSHPTSCSSSSEIMSVLFFYIMRYKQSDPENPDNDRFVLAKRLSFVDVATGWLGQGLGVACGMAYTGKYFDRASYRVFCLMSDGESS
Specificity
Specificity of human TKTL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TKTL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TKTL1 Recombinant Protein Antigen (NBP1-86939PEP)
Publications
Read Publications using
NBP1-86939 in the following applications:

  • IHC
    1 publication
  • 1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26187043).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TKTL1 Antibody

  • TK 2
  • TKR EC 2.2.1.1
  • TKR
  • TKT2Transketolase 2
  • transketolase-2
  • transketolase-like 1
  • transketolase-like protein 1
  • Transketolase-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF2538
Species: Hu
Applications: WB, Simple Western, IHC
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-83164
Species: Hu
Applications: WB, IHC, IHC-P
MAB7940
Species: Hu
Applications: WB, IHC
NB100-79794
Species: Hu
Applications: WB, IHC, IP
NBP2-02677
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-20650
Species: Hu, Mu
Applications: WB
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TKTL1 Antibody (NBP1-86939)(2)

Reviews for TKTL1 Antibody (NBP1-86939) (0)

There are no reviews for TKTL1 Antibody (NBP1-86939). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TKTL1 Antibody (NBP1-86939) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TKTL1 Antibody (NBP1-86939)

Discover related pathways, diseases and genes to TKTL1 Antibody (NBP1-86939). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TKTL1 Antibody (NBP1-86939)

Discover more about diseases related to TKTL1 Antibody (NBP1-86939).
 

Pathways for TKTL1 Antibody (NBP1-86939)

View related products by pathway.

PTMs for TKTL1 Antibody (NBP1-86939)

Learn more about PTMs related to TKTL1 Antibody (NBP1-86939).

Blogs on TKTL1

There are no specific blogs for TKTL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TKTL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TKTL1