SPAG9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SPAG9 Antibody [NBP1-85393] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & microtubule organizing center.
Immunohistochemistry-Paraffin: SPAG9 Antibody [NBP1-85393] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: SPAG9 Antibody [NBP1-85393] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.
Immunohistochemistry-Paraffin: SPAG9 Antibody [NBP1-85393] - Analysis in human testis and skeletal muscle tissues using NBP1-85393 antibody. Corresponding SPAG9 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SPAG9 Antibody [NBP1-85393] - Staining of human Liver shows very weak cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: SPAG9 Antibody [NBP1-85393] - Staining of human Lymph node shows very weak cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: SPAG9 Antibody [NBP1-85393] - Staining of human Testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPAG9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQTGVYTEHVFTDPLGVQIPEDLSPVYQSSN
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPAG9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPAG9 Protein (NBP1-85393PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPAG9 Antibody

  • Cancer/testis antigen 89
  • c-Jun NH2-terminal kinase-associated leucine zipper protein
  • C-Jun-amino-terminal kinase-interacting protein 4
  • CT89JIP4
  • FLJ14006
  • FLJ26141
  • FLJ34602
  • HLC4
  • HLC-6
  • HSS
  • Human lung cancer oncogene 6 protein
  • JLPPHETSYD1FLJ13450
  • JNK interacting protein
  • JNK/SAPK-associated protein
  • JNK-associated leucine-zipper protein
  • JNK-interacting protein 4
  • KIAA0516JIP-4
  • lung cancer oncogene 4
  • MAPK8IP4
  • Max-binding protein
  • MGC117291
  • MGC14967
  • MGC74461
  • Mitogen-activated protein kinase 8-interacting protein 4
  • PIG6
  • proliferation-inducing gene 6
  • Proliferation-inducing protein 6
  • Protein highly expressed in testis
  • sperm associated antigen 9
  • Sperm surface protein
  • Sperm-associated antigen 9
  • Sperm-specific protein
  • Sunday driver 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-82648
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1205
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-17184
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-84999
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85416
Species: Hu
Applications: IHC, IHC-P
236-EG
Species: Hu
Applications: BA
NBP1-88713
Species: Hu
Applications: IHC, IHC-P, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NBP1-81637
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-90267
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF2429
Species: Mu
Applications: IHC, WB
NBP1-85393
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SPAG9 Antibody (NBP1-85393) (0)

There are no publications for SPAG9 Antibody (NBP1-85393).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPAG9 Antibody (NBP1-85393) (0)

There are no reviews for SPAG9 Antibody (NBP1-85393). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SPAG9 Antibody (NBP1-85393) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPAG9 Products

Bioinformatics Tool for SPAG9 Antibody (NBP1-85393)

Discover related pathways, diseases and genes to SPAG9 Antibody (NBP1-85393). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPAG9 Antibody (NBP1-85393)

Discover more about diseases related to SPAG9 Antibody (NBP1-85393).
 

Pathways for SPAG9 Antibody (NBP1-85393)

View related products by pathway.

PTMs for SPAG9 Antibody (NBP1-85393)

Learn more about PTMs related to SPAG9 Antibody (NBP1-85393).
 

Research Areas for SPAG9 Antibody (NBP1-85393)

Find related products by research area.

Blogs on SPAG9

There are no specific blogs for SPAG9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPAG9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPAG9