Connexin 43/GJA1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Connexin 43/GJA1 Antibody [NBP2-38234] - Staining in human parathyroid gland and liver tissues using anti-GJA1 antibody. Corresponding GJA1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Connexin 43/GJA1 Antibody [NBP2-38234] - Staining of human Skin shows strong membranous positivity in epidermal cells.

Immunohistochemistry-Paraffin: Connexin 43/GJA1 Antibody [NBP2-38234] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: Connexin 43/GJA1 Antibody [NBP2-38234] - Staining of human parathyroid gland shows high expression.

Immunohistochemistry-Paraffin: Connexin 43/GJA1 Antibody [NBP2-38234] - Staining of human Endometrium shows strong membranous positivity in cells in endometrial stroma.

Immunohistochemistry-Paraffin: Connexin 43/GJA1 Antibody [NBP2-38234] - Staining of human Heart muscle shows strong membranous positivity in cardiomyocytes.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Connexin 43/GJA1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Connexin 43/GJA1 Antibody - BSA Free (NBP2-38234) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPR
• Predicted Species: Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GJA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Connexin 43/GJA1 Protein (NBP2-38234PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Connexin 43/GJA1 Antibody - BSA Free

• Connexin 43
• connexin-43
• CX43
• CX43gap junction protein, alpha-like
• DFNB38
• Gap junction 43 kDa heart protein
• gap junction alpha-1 protein
• gap junction protein, alpha 1, 43kDa (connexin 43)
• gap junction protein, alpha 1, 43kDa
• GJA1
• GJAL
• HSS
• ODD
• ODDD
• ODOD
• SDTY3

Background

Connexin 43/GJA1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. GJA1 is the major cardiac gap junction protein, which is thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. GJA1 is targeted by several protein kinases that regulate myocardial cell cell coupling. A related intronless GJA1 pseudogene, GJA1P, has been mapped to chromosome 5.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GJA1
• Uniprot:
  • P17302()