Sulfamidase/SGSH Antibody

Images

 
Western Blot: SGSH Antibody [NBP1-83164] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-522
Immunohistochemistry-Paraffin: SGSH Antibody [NBP1-83164] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sulfamidase/SGSH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEKLSPQCQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGSH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Sulfamidase/SGSH Protein (NBP1-83164PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sulfamidase/SGSH Antibody

  • heparan sulfate sulfatase
  • HSS
  • HSSN-sulphoglucosamine sulphohydrolase
  • MPS3A
  • MPS3Asulphamidase
  • N-sulfoglucosamine sulfohydrolase
  • SFMD
  • SFMDEC 3.10.1.1
  • SGSH
  • Sulfamidase
  • Sulfoglucosamine sulfamidase
  • Sulphamidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82474
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02377
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31555
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB110-92756
Species: Hu, Mu, Ch, Re
Applications: WB
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF7174
Species: Hu
Applications: WB, ICC

Publications for Sulfamidase/SGSH Antibody (NBP1-83164) (0)

There are no publications for Sulfamidase/SGSH Antibody (NBP1-83164).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sulfamidase/SGSH Antibody (NBP1-83164) (0)

There are no reviews for Sulfamidase/SGSH Antibody (NBP1-83164). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sulfamidase/SGSH Antibody (NBP1-83164) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sulfamidase/SGSH Products

Bioinformatics Tool for Sulfamidase/SGSH Antibody (NBP1-83164)

Discover related pathways, diseases and genes to Sulfamidase/SGSH Antibody (NBP1-83164). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sulfamidase/SGSH Antibody (NBP1-83164)

Discover more about diseases related to Sulfamidase/SGSH Antibody (NBP1-83164).
 

Pathways for Sulfamidase/SGSH Antibody (NBP1-83164)

View related products by pathway.

Blogs on Sulfamidase/SGSH

There are no specific blogs for Sulfamidase/SGSH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sulfamidase/SGSH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SGSH
Entrez