TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Images

 
There are currently no images for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-31274).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications Flow, Func
Concentration
LYOPH

Order Details

TIRAP (TLR2 and TLR4) Inhibitor Peptide Set Summary

Immunogen
TLR2 / TLR4 Inhibitor Peptide: 1 mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML);
Specificity
TLR2 and TLR4 Inhibitor Peptide: COBRA TLR2 and TLR4 Inhibitor interferes with interaction between TIRAP/Mal and TIR domain of TLR2 or TLR4.
Preparation
Method
Preparation of 2.5 mM peptide stock solutions
TLR2 / TLR4 Inhibitor Peptide: A final volume of 100 ul will make a 2.5 mM stock solution. Add 100 ul sterile water to the tube of peptide. Carefully pipet to ensure all of the peptide is dissolved and briefly spin the tube before opening.

The stock solutions may be diluted further to make working solutions. Dilute according to the needs for your assay. For example, dilute 2.5 mM stock solutions 1:10 in sterile 1X PBS or cell culture media to make 250 uM working solutions. Working solution should be made fresh daily and not be stored.

Please contact technical support for detailed reconstitution instructions.
Content
Antennapedia Control Peptide: 1 mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da
Gene
TIRAP

Applications/Dilutions

Dilutions
  • Flow Cytometry
  • Functional
Application Notes
The inhibitor is used in assays to inhibit TLR2 and TLR4 signaling. We recommend an initial titration of the inhibitor from 0-50 uM for in vitro assays along with control of which concentrations should be mirror inhibitor concentrations. Inhibitor and control should be preincubated with cells prior to ligand activation to allow sufficient time for the peptides to enter from the media into the cell. We typically preincubate with inhibitor and control for 1 h prior to TLR2 or TLR4 activation (Figures 1 and 2); however, optimal preincubation times may vary between model systems. FLOW and Functional application reported by Alvarez et al - Conference on Retroviruses and Opportunistic Infections - CROI 2014 (Abstract: The NCOR2-Nurr1-CoREST Transrepression Axis Impairs HIV Reactivation in Latently Infected Microglial Cells)
Publications
Read Publication using
NBP2-31274 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
Lyophilized white powder
Concentration
LYOPH

Alternate Names for TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

  • adapter protein wyatt
  • Adaptor protein Wyatt
  • FLJ42305
  • Mal
  • MyD88 adapter-like protein
  • TIR domain-containing adapter protein
  • toll/interleukin-1 receptor domain-containing adapter protein
  • toll-interleukin 1 receptor (TIR) domain containing adaptor protein
  • Toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
  • Toll-like receptor adaptor protein
  • wyatt

Background

TIRAP/Mal is an adapter protein in the signaling pathways activated by TLR2 and TLR4, and appears to be essential for MyD88-dependent TLR2 and TLR4 signaling pathways. TIRAP is recruited to activated TL2 and TLR4 through interaction with TIR domain of the receptor. This peptide contains a sequence from mouse TIRAP that blocks the function of TIRAP, likely through binding to the receptor and blocking TIR-TIR domain interaction between TIRAP and the receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Inhibitors are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NB120-13810
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-24686
Species: Bv, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC,  IHC-P, WB
NB100-1207
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP3-47457
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF,  IHC-P, IP, PA, WB
201-LB
Species: Hu
Applications: BA
NBP1-88498
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF4479
Species: Hu
Applications: IHC
AF009
Species: Hu
Applications: IHC, WB
AF2254
Species: Mu
Applications: IHC, WB
NBP2-24729
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC,  IHC-P, IP, In vitro, KD, Simple Western, WB
NB100-56563
Species: Hu, Mu, Rt
Applications: DB, Flow-CS, Flow-IC, Flow, IHC,  IHC-P, WB
8499-IF
Species: Hu
Applications: BA
Supplier Logo

Publications for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-31274)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: FLOW, Func.


Filter By Application
FLOW
(1)
Func
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP2-31274 Applications Species
Alvarez D, Das B, Garcia-Mesa Y et al. The NCOR2-Nurr1-CoREST Transrepression Axis Impairs HIV Reactivation in Latently Infected Microglial Cells Conference on Retroviruses and Opportunistic Infections (CROI) 2014. (Func, FLOW, Human)

Details:
TIRAP/COBRA (TLR2 or TLR4) inhibitor used at 20uM concentration on Microglial/HIV Cells - CHME-5/HIV and hT-HMucroglia/HIV cells were untreated or treated with IL-1 beta (100 pg/mL), Pam3CSK4 (0.1 ug/mL), or a combination of IL-1 beta and Pam3CSK4 for 16 h prior to measuring GFP-expressing cells by FLOW (Fig 4B). COBRA, but not of VIPER, abolished the effect of Pam3CSK4, but not of IL-1 beta indicating that Pam3CSK4 is indeed responsible for the potentiation of HIV reactivation
Func, FLOW Human

Reviews for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-31274) (0)

There are no reviews for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-31274). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-31274) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TIRAP (TLR2 and TLR4) Products

Research Areas for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-31274)

Find related products by research area.

Blogs on TIRAP (TLR2 and TLR4)

There are no specific blogs for TIRAP (TLR2 and TLR4), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Review this Product

Be the first to review our TIRAP (TLR2 and TLR4) Inhibitor Peptide Set and receive a gift card or discount.

Bioinformatics

Gene Symbol TIRAP