| Reactivity | Hu, MuSpecies Glossary |
| Applications | Flow, Func |
| Concentration | LYOPH |
| Immunogen | TLR2 / TLR4 Inhibitor Peptide: 1 mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); |
| Specificity | TLR2 and TLR4 Inhibitor Peptide: COBRA TLR2 and TLR4 Inhibitor interferes with interaction between TIRAP/Mal and TIR domain of TLR2 or TLR4. |
| Preparation Method |
Preparation of 2.5 mM peptide stock solutions TLR2 / TLR4 Inhibitor Peptide: A final volume of 100 ul will make a 2.5 mM stock solution. Add 100 ul sterile water to the tube of peptide. Carefully pipet to ensure all of the peptide is dissolved and briefly spin the tube before opening. The stock solutions may be diluted further to make working solutions. Dilute according to the needs for your assay. For example, dilute 2.5 mM stock solutions 1:10 in sterile 1X PBS or cell culture media to make 250 uM working solutions. Working solution should be made fresh daily and not be stored. Please contact technical support for detailed reconstitution instructions. |
| Content | Antennapedia Control Peptide: 1 mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da |
| Gene | TIRAP |
| Dilutions |
|
|
| Application Notes | The inhibitor is used in assays to inhibit TLR2 and TLR4 signaling. We recommend an initial titration of the inhibitor from 0-50 uM for in vitro assays along with control of which concentrations should be mirror inhibitor concentrations. Inhibitor and control should be preincubated with cells prior to ligand activation to allow sufficient time for the peptides to enter from the media into the cell. We typically preincubate with inhibitor and control for 1 h prior to TLR2 or TLR4 activation (Figures 1 and 2); however, optimal preincubation times may vary between model systems. FLOW and Functional application reported by Alvarez et al - Conference on Retroviruses and Opportunistic Infections - CROI 2014 (Abstract: The NCOR2-Nurr1-CoREST Transrepression Axis Impairs HIV Reactivation in Latently Infected Microglial Cells) |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | Lyophilized white powder |
| Concentration | LYOPH |
| Publication using NBP2-31274 | Applications | Species |
|---|---|---|
| Alvarez D, Das B, Garcia-Mesa Y et al. The NCOR2-Nurr1-CoREST Transrepression Axis Impairs HIV Reactivation in Latently Infected Microglial Cells Conference on Retroviruses and Opportunistic Infections (CROI) 2014. (Func, FLOW, Human) Details: TIRAP/COBRA (TLR2 or TLR4) inhibitor used at 20uM concentration on Microglial/HIV Cells - CHME-5/HIV and hT-HMucroglia/HIV cells were untreated or treated with IL-1 beta (100 pg/mL), Pam3CSK4 (0.1 ug/mL), or a combination of IL-1 beta and Pam3CSK4 for 16 h prior to measuring GFP-expressing cells by FLOW (Fig 4B). COBRA, but not of VIPER, abolished the effect of Pam3CSK4, but not of IL-1 beta indicating that Pam3CSK4 is indeed responsible for the potentiation of HIV reactivation |
Func, FLOW | Human |
Research Areas for TIRAP (TLR2 and TLR4) Inhibitor (NBP2-31274)Find related products by research area.
|
| Gene Symbol | TIRAP |