Mkl1 Antibody

Images

 
Western Blot: Mkl1 Antibody [NBP1-88498] - Analysis in human cell line HL-60.
Immunocytochemistry/ Immunofluorescence: Mkl1 Antibody [NBP1-88498] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Mkl1 Antibody [NBP1-88498] - Staining of human lymph node shows cytoplasmic positivity in lymphocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Mkl1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MKL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Mkl1 Protein (NBP1-88498PEP)
Publications
Read Publications using
NBP1-88498 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Mkl1 Antibody

  • AMKL
  • KIAA1438
  • MALSAP and coiled-coil domain
  • megakaryoblastic leukemia (translocation) 1
  • Megakaryoblastic leukemia 1 protein
  • Megakaryocytic acute leukemia protein
  • MKL/myocardin-like protein 1
  • Myocardin-related transcription factor A
  • RNA-binding motif protein 15/megakaryoblastic leukemia-1 fusion protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
AF4348
Species: Hu, Mu, Rt
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP1-46209
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC-P, IP
MAB4028
Species: Hu, Mu
Applications: WB
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3646
Species: Hu
Applications: WB, ICC
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-80669
Species: Hu
Applications: IHC, IHC-P
NBP1-82465
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp

Publications for Mkl1 Antibody (NBP1-88498)(5)

Reviews for Mkl1 Antibody (NBP1-88498) (0)

There are no reviews for Mkl1 Antibody (NBP1-88498). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Mkl1 Antibody (NBP1-88498) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mkl1 Products

Bioinformatics Tool for Mkl1 Antibody (NBP1-88498)

Discover related pathways, diseases and genes to Mkl1 Antibody (NBP1-88498). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mkl1 Antibody (NBP1-88498)

Discover more about diseases related to Mkl1 Antibody (NBP1-88498).
 

Pathways for Mkl1 Antibody (NBP1-88498)

View related products by pathway.

PTMs for Mkl1 Antibody (NBP1-88498)

Learn more about PTMs related to Mkl1 Antibody (NBP1-88498).

Blogs on Mkl1

There are no specific blogs for Mkl1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mkl1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MKL1
Entrez
Uniprot