Mkl1 Antibody

Images

 
Genetic Strategies: Western Blot: Mkl1 Antibody [NBP1-88498] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: Mkl1 Antibody [NBP1-88498] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Mkl1 Antibody [NBP1-88498] - Staining of human testis shows positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Mkl1 Antibody [NBP1-88498] - Staining of human liver shows very weak positivity in hepatocytes.
Immunohistochemistry-Paraffin: Mkl1 Antibody [NBP1-88498] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: Mkl1 Antibody [NBP1-88498] - Staining of human lymph node shows moderate positivity in lymphoid cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Mkl1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRTFA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 26224645). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Mkl1 Protein (NBP1-88498PEP)
Publications
Read Publications using
NBP1-88498 in the following applications:

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 26165921)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Mkl1 Antibody

  • AMKL
  • KIAA1438
  • MALSAP and coiled-coil domain
  • megakaryoblastic leukemia (translocation) 1
  • Megakaryoblastic leukemia 1 protein
  • Megakaryocytic acute leukemia protein
  • MKL/myocardin-like protein 1
  • Myocardin-related transcription factor A
  • RNA-binding motif protein 15/megakaryoblastic leukemia-1 fusion protein

Background

MKL1 (megakaryoblastic leukemia 1 protein) was identified as part of a t(1;22) translocation with RBM15 associated with acute megakaryoblastic leukemia. It is a transcriptional coactivator of serum response factor (SRF) that promotes muscle differentiation and also plays a role in promoting maturation of megakaryocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NBP2-26245
Species: Hu, Mu
Applications: Flow, In vitro
NB120-13810
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP2-24686
Species: Bv, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-46209
Species: Hu, Pm, Mu
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
H00057152-M06
Species: Hu, Mu
Applications: ELISA, IHC-Fr, IP, WB
AF009
Species: Hu
Applications: IHC, WB
NB100-1207
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF2254
Species: Mu
Applications: IHC, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-80669
Species: Hu
Applications: IHC, IHC-P
NBP1-82465
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB

Publications for Mkl1 Antibody (NBP1-88498)(8)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IF/IHC, WB.


Filter By Application
ICC/IF
(1)
IF/IHC
(1)
WB
(3)
All Applications
Filter By Species
Human
(4)
Mouse
(2)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-88498 Applications Species
Yao CD, Haensel D, Gaddam S et al. AP-1 and TGF beta cooperativity drives non-canonical Hedgehog signaling in resistant basal cell carcinoma Nat Commun 2020-10-08 [PMID: 33033234] (IF/IHC, Human, Mouse) IF/IHC Human, Mouse
Paredes F, Williams HC, Quintana RA, San Martin A. Mitochondrial Protein Poldip2 (Polymerase Delta Interacting Protein 2) Controls Vascular Smooth Muscle Differentiated Phenotype by O-Linked GlcNAc (N-Acetylglucosamine) Transferase-Dependent Inhibition of a Ubiquitin Proteasome System Circulation Research 2020-01-03 [PMID: 31656131]
Whitson RJ, Lee A, Urman NM, Mirza A. Noncanonical hedgehog pathway activation through SRF-MKL1 promotes drug resistance in basal cell carcinomas. Nat. Med. 2018-02-05 [PMID: 29400712] (WB, Human) WB Human
Record J, Malinova D, Zenner HL et al. Immunodeficiency and severe susceptibility to bacterial infection associated with a loss-of-function homozygous mutation of MKL1. Blood 2015-09-24 [PMID: 26224645] (WB, Human) WB Human
Gjorevski N, S. Piotrowski A, Varner VD, Nelson CM. Dynamic tensile forces drive collective cell migration through three-dimensional extracellular matrices. Sci Rep 2015-07-13 [PMID: 26165921] (ICC/IF, Mouse) ICC/IF Mouse
Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]
Schmidt LJ, Duncan K, Yadav N et al. RhoA as a mediator of clinically relevant androgen action in prostate cancer cells. Mol Endocrinol. 2012-05-01 [PMID: 22456196] (WB, Human) WB Human
Muehlich S, Hampl V, Khalid S et al. The transcriptional coactivators megakaryoblastic leukemia 1/2 mediate the effects of loss of the tumor suppressor deleted in liver cancer 1. Oncogene 2012-08-30 [PMID: 22139079]

Reviews for Mkl1 Antibody (NBP1-88498) (0)

There are no reviews for Mkl1 Antibody (NBP1-88498). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Mkl1 Antibody (NBP1-88498) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mkl1 Products

Array NBP1-88498

Diseases for Mkl1 Antibody (NBP1-88498)

Discover more about diseases related to Mkl1 Antibody (NBP1-88498).
 

Pathways for Mkl1 Antibody (NBP1-88498)

View related products by pathway.

PTMs for Mkl1 Antibody (NBP1-88498)

Learn more about PTMs related to Mkl1 Antibody (NBP1-88498).
 

Research Areas for Mkl1 Antibody (NBP1-88498)

Find related products by research area.

Blogs on Mkl1

There are no specific blogs for Mkl1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mkl1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRTFA
Entrez
Uniprot